BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_K05 (866 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 24 1.3 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 24 1.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 5.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.4 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 330 VRSVTNPENNEASIEHSHHTVDTGLD-QPIESHRNTRDLRFLYPRGKLPVPTLPPFNPKP 506 ++ N N+ +++H ++ L Q + S+ N + + P G + T+P + P P Sbjct: 97 LKKCQNVGMNKDAVQHERGPRNSTLRRQQMSSYYNESRV-MMSPPGNVLNLTMPKYEPNP 155 Query: 507 IYIDMG 524 ID G Sbjct: 156 SIIDPG 161 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 330 VRSVTNPENNEASIEHSHHTVDTGLD-QPIESHRNTRDLRFLYPRGKLPVPTLPPFNPKP 506 ++ N N+ +++H ++ L Q + S+ N + + P G + T+P + P P Sbjct: 97 LKKCQNVGMNKDAVQHERGPRNSTLRRQQMSSYYNESRV-MMSPPGNVLNLTMPKYEPNP 155 Query: 507 IYIDMG 524 ID G Sbjct: 156 SIIDPG 161 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +3 Query: 276 PILPSKIDDVQLDPNRRYVRSVTNPENNEASIEH 377 PI DD+ + + +S+TN + +++H Sbjct: 284 PIWTRNADDISQEEYGEFYKSLTNDWEDHLAVKH 317 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 5.4 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = +3 Query: 159 QATANTAPDNTYSATSWPGTAMAVSRVTMFLXA-PSTADHPILPSKIDDVQLDPNRRYVR 335 QAT +AP TYS S T V T+ + S+ P S PN+ Y + Sbjct: 293 QATPYSAPGPTYSTWSTVQTPTTVMSPTINCWSLTSSPPPPYQISAQPTPSQSPNQIY-Q 351 Query: 336 SVTNPEN 356 VTN N Sbjct: 352 PVTNLTN 358 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,090 Number of Sequences: 336 Number of extensions: 4266 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23893023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -