BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_J19 (979 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69302-5|CAA93262.1| 189|Caenorhabditis elegans Hypothetical pr... 169 3e-42 U41275-3|AAA82466.1| 612|Caenorhabditis elegans Hypothetical pr... 28 8.8 >Z69302-5|CAA93262.1| 189|Caenorhabditis elegans Hypothetical protein F40F8.10 protein. Length = 189 Score = 169 bits (410), Expect = 3e-42 Identities = 81/100 (81%), Positives = 90/100 (90%) Frame = +1 Query: 112 SVFSKPYVXPRRPFEKARLDQALKLIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEK 291 +V SK PRRPFEK RLDQ LKLIG +GL+NKREVWRVKYTLA++RKAARELLTLE+K Sbjct: 6 TVQSKVTKSPRRPFEKERLDQELKLIGTFGLKNKREVWRVKYTLAKVRKAARELLTLEDK 65 Query: 292 DPKXLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFL 411 DPK LFEGNALLRRLV+IGVLDE +MKLDYVLGLK+EDFL Sbjct: 66 DPKRLFEGNALLRRLVKIGVLDETKMKLDYVLGLKVEDFL 105 Score = 58.8 bits (136), Expect = 5e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 413 ERRLQTQVFKAGLAKSIHHARILIRQRHIR 502 ERRLQTQVFK GLAKSIHHARILI+Q HIR Sbjct: 106 ERRLQTQVFKLGLAKSIHHARILIKQHHIR 135 >U41275-3|AAA82466.1| 612|Caenorhabditis elegans Hypothetical protein T25D1.1 protein. Length = 612 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -1 Query: 481 QNSGMMDGLRQASFEHLRLQTTLPRSPQSSDQAHNRVSSVFHPVLQYEPDDVEGHYLRTX 302 QNS + + Q +E+ + P SPQ S+Q H+ +++ P++ E + H + Sbjct: 219 QNSTITEQANQFRYENRAATSERPPSPQFSNQHHDATNAM--PIVYQE---TQLHATKGG 273 Query: 301 SWGP 290 W P Sbjct: 274 KWSP 277 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,485,152 Number of Sequences: 27780 Number of extensions: 243493 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2542323834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -