BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_J08 (888 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) 29 3.8 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 493 LPSAVLLKPVAQPPTKFSLPSFSVV-VLPADVGVGTIVGWVTNSTTPRCTE 344 LPS + V F + S+V +LP+D GV T GW NS+ P E Sbjct: 44 LPSNRTVLDVEDDDGYFIIKRLSIVDMLPSDAGVYTCQGWTYNSSAPSDVE 94 >SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) Length = 966 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 300 AVNRPVYPTEXXXXXXXXXXXXEFVTQPTIVPTPTSAGKTTTEKEGRE 443 AV R ++PTE E+ +P +VPT + + +E+ GRE Sbjct: 808 AVPREIFPTEETEVIPTEETE-EYTEEPEVVPTEEPSDEEESEEAGRE 854 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,238,838 Number of Sequences: 59808 Number of extensions: 202188 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -