BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I17 (1115 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 28 0.58 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 27.9 bits (59), Expect = 0.58 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +3 Query: 108 KHENCVDFSR--GLIAPRLLSSTGTLKFQNXXRVGCWRXRRKKQKEGFRSP 254 KHE C R +A + S TGTL + RV WR + F P Sbjct: 390 KHEGCSSHERLHPFMASQAASGTGTLTQFSELRVKAWRREFLSKNATFSRP 440 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,409 Number of Sequences: 2352 Number of extensions: 9598 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 125796294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -