BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I16 (1005 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1201 - 11419851-11419913,11420090-11420311 31 1.4 05_03_0032 - 7582595-7582690,7582879-7583004,7583119-7583185,758... 30 2.5 06_03_0828 + 25137782-25138312,25141349-25141588 30 3.3 >07_01_1201 - 11419851-11419913,11420090-11420311 Length = 94 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 661 RCXNPTGL*XYQXFPPGXLPLALSCSDPAAYXIPVRPFXPS 783 R PTG + FP G LP A PA P P PS Sbjct: 30 RSTGPTGKLCFCSFPAGALPPAAGAGQPAPDRQPATPLFPS 70 >05_03_0032 - 7582595-7582690,7582879-7583004,7583119-7583185, 7583268-7583470 Length = 163 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -1 Query: 882 GFGXXRPRXGGGXTYTXSGXPNXVXYGEXXTXXGRGERADRYSVSGRVGTGEG 724 G G PR GGG + N YG GE YS S GT EG Sbjct: 11 GAGDENPRGGGGENTMGTSGGNPRGYGGRGPRGCSGESPRGYSNSKPTGTVEG 63 >06_03_0828 + 25137782-25138312,25141349-25141588 Length = 256 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 804 GEXXTXXGRGERADRYSVSGRVGTGEGKREXSRG 703 GE GR R + + R+G GEG+R RG Sbjct: 57 GEAGRGRGRQRRQEGRQIRARLGEGEGRRRRGRG 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,535,236 Number of Sequences: 37544 Number of extensions: 258048 Number of successful extensions: 497 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2952114480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -