BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I15 (1010 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00260.1 68417.m00033 transcriptional factor B3 family protei... 31 1.6 >At4g00260.1 68417.m00033 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 528 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 135 FFDANGLRAGDQVLCRWLLVAGVCFRRCFGNSPRD 239 F DANGL+AGD + + AG R N P++ Sbjct: 200 FCDANGLKAGDNYTFKLIKRAGTLVLRLLPNEPKE 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,837,195 Number of Sequences: 28952 Number of extensions: 365413 Number of successful extensions: 891 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2479989240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -