BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I11 (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 31 0.035 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.3 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 7.0 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 9.2 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 31.5 bits (68), Expect = 0.035 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 334 LDCTTSECDQLCRRFGFSGGICVGGQCECGNI 429 L CT C CR G+ G C G+C C + Sbjct: 63 LTCTNPTCSAQCRGRGYRRGSCTIGRCFCSYV 94 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +3 Query: 180 IKLRNCDFMACDQLCRELGFPSGACDGEQCVC 275 ++ C C CR G+ G+C +C C Sbjct: 60 VQTLTCTNPTCSAQCRGRGYRRGSCTIGRCFC 91 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 2.3 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 337 DCTTSECDQ----LCRRFGFSGGICVGGQCEC 420 +C CD+ LC G G CV GQCEC Sbjct: 589 ECDNFSCDRPGGLLCS--GPDHGRCVCGQCEC 618 Score = 24.6 bits (51), Expect = 4.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 219 LCRELGFPSGACDGEQCVCDNF 284 +C P DG C CDNF Sbjct: 572 VCERRPNPDELIDGRYCECDNF 593 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 7.0 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 141 NIFDEGLNTNKTSIKLRNC--DFMACDQL 221 ++ DE N+TS++ RNC +F C + Sbjct: 814 DVLDESQFCNETSVRDRNCRQEFCECSHV 842 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 28 KDFEFNFMRQNWIEVTNAIYTVFCECFVHCTCIS 129 ++FEF+ R +E+ IY CEC C +S Sbjct: 888 REFEFDPAR-TVLEICR-IYVNLCECDAFCLAVS 919 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 878,232 Number of Sequences: 2352 Number of extensions: 16487 Number of successful extensions: 35 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -