BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I10 (890 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) 30 2.2 SB_149| Best HMM Match : rve (HMM E-Value=6.3e-20) 29 5.1 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 6.7 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 29 6.7 SB_9820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) 28 8.8 >SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) Length = 503 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +2 Query: 296 DGSESVLQQLNAFAKSLQGALGDANGKAKEALEQSRQNIERTAEELRK 439 +G+E+ + QL +SLQ L DA +++ L++S +E ++ K Sbjct: 420 EGTETAIHQLKKENESLQTRLSDAQALSQKQLKESSSRLEEMHQQHNK 467 >SB_149| Best HMM Match : rve (HMM E-Value=6.3e-20) Length = 2232 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 428 PRPCARCSASTVPKPPWPCRSRLRALPGD 342 P+ RC +S PW C S + AL GD Sbjct: 821 PKRIPRCESSETRHWPWSCASGIAALVGD 849 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 509 VFCTAACSFSPEGGGVLLDVQGGPCGAPRPCARCSASTVPKPPWP 375 +F A C +G + L +G CG P P C T PK P Sbjct: 203 LFLVAKCKAKKDGRRLKLKYRGA-CGNPTPRKSCPPRTCPKQDKP 246 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 28.7 bits (61), Expect = 6.7 Identities = 21/71 (29%), Positives = 30/71 (42%) Frame = +3 Query: 75 SSALSLSTVHHGRQVRSSLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP*DFXNNSLTRS 254 S + S S H + RS R P+ + RRSR Q R+P + + S Sbjct: 214 SRSRSRSRSHRKSRKRSESRSRSRSPKKSRSARRSRSPQKSRSPQRSRS-PRSSKRYRSS 272 Query: 255 PSQRTHRTSAR 287 S R HR+ +R Sbjct: 273 RSHRKHRSHSR 283 >SB_9820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 425 RPCARCSASTVPKPPWPCRSRLRALPGD 342 + C C P PP PC+ R+ LP D Sbjct: 121 KSCFSCRRRQQPPPPPPCQQRMADLPVD 148 >SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) Length = 337 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 290 WKDGSESVLQQLNAFAKSLQGALGDANGKAKEALEQSR 403 ++D SES ++N F +G+ D +G K + +SR Sbjct: 183 YEDNSESNKDEINVFESLREGSTIDESGSEKSSFSESR 220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,980,553 Number of Sequences: 59808 Number of extensions: 330823 Number of successful extensions: 1085 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -