BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_I01 (1059 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 31 1.8 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 29 4.2 AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen prot... 29 4.2 AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi dom... 29 4.2 AL032654-7|CAA21719.1| 219|Caenorhabditis elegans Hypothetical ... 29 5.6 Z81106-2|CAB03220.2| 468|Caenorhabditis elegans Hypothetical pr... 29 7.4 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 29 7.4 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 29 7.4 AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical... 29 7.4 Z99281-39|CAE45094.2| 665|Caenorhabditis elegans Hypothetical p... 28 9.8 Z99281-38|CAE45095.2| 845|Caenorhabditis elegans Hypothetical p... 28 9.8 Z99281-36|CAB16527.3| 862|Caenorhabditis elegans Hypothetical p... 28 9.8 Z99281-34|CAJ44243.1| 917|Caenorhabditis elegans Hypothetical p... 28 9.8 U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 28 9.8 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 28 9.8 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 28 9.8 AY611484-1|AAT37523.1| 917|Caenorhabditis elegans epidermal gro... 28 9.8 AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily a... 28 9.8 AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily a... 28 9.8 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 28 9.8 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPPXXPT 432 P A PP PP P PPP P+ Sbjct: 354 PPAPPPPPPPPPPPPPPQTPS 374 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPPXXP 429 P +PP PP P PPP P Sbjct: 350 PIISPPAPPPPPPPPPPPPP 369 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 382 PPXXXPPXPXPPPXXPTRP 438 PP PP P PPP P P Sbjct: 349 PPIISPPAPPPPPPPPPPP 367 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 855 PPPPAXXPPPXPPR 896 PPPP PPP PP+ Sbjct: 358 PPPPPPPPPPPPPQ 371 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPPXXP 429 P ATP PP P PPP P Sbjct: 504 PIATPSSVPPPPPPPPPPPP 523 >AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen protein 51 protein. Length = 435 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 364 DGPXATPPXXXPPXPXPPPXXPTRPXRXGXXXXPFA 471 DG +PP PP P PP +P G P A Sbjct: 204 DGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPGA 239 >AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi domain-containing protein2 protein. Length = 975 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPPXXPTRP 438 P PP PP P PP PT P Sbjct: 21 PVTAPPGLHPPPPVPPVPVPTLP 43 >AL032654-7|CAA21719.1| 219|Caenorhabditis elegans Hypothetical protein Y52B11A.5 protein. Length = 219 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 858 PPPAXXPPPXPPR 896 PPPA PPP PPR Sbjct: 29 PPPARPPPPPPPR 41 >Z81106-2|CAB03220.2| 468|Caenorhabditis elegans Hypothetical protein R06C1.3 protein. Length = 468 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPP 420 P A PP PP P PPP Sbjct: 349 PSAAPPTNIPPPPPPPP 365 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 28.7 bits (61), Expect = 7.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP+ PPP PP Sbjct: 135 PPPPSPPPPPPPP 147 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 858 PPPAXXPPPXPPRCRXXXXPXXXXXXXXXQLSPP 959 PPP PPP PP C P Q PP Sbjct: 27 PPPC--PPPPPPMCAPPPLPCPPPPICPPQFCPP 58 >AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical protein Y116A8C.35 protein. Length = 285 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 898 QRGGXGGGXXAGGGG 854 QRGG GGG GGGG Sbjct: 211 QRGGSGGGGGGGGGG 225 >Z99281-39|CAE45094.2| 665|Caenorhabditis elegans Hypothetical protein Y57G11C.24e protein. Length = 665 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 469 PPPPVVIPPPPPP 481 >Z99281-38|CAE45095.2| 845|Caenorhabditis elegans Hypothetical protein Y57G11C.24d protein. Length = 845 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 649 PPPPVVIPPPPPP 661 >Z99281-36|CAB16527.3| 862|Caenorhabditis elegans Hypothetical protein Y57G11C.24a protein. Length = 862 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 666 PPPPVVIPPPPPP 678 >Z99281-34|CAJ44243.1| 917|Caenorhabditis elegans Hypothetical protein Y57G11C.24g protein. Length = 917 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 721 PPPPVVIPPPPPP 733 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 762 PPPPGGCPPPPPP 774 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 762 PPPPGGCPPPPPP 774 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 370 PXATPPXXXPPXPXPPPXXP 429 P PP PP P PPP P Sbjct: 68 PPICPPPPPPPMPCPPPPPP 87 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 855 PPPPAXXPPPXPPRCR 902 PPPP PPP PP R Sbjct: 75 PPPPMPCPPPPPPMPR 90 >AY611484-1|AAT37523.1| 917|Caenorhabditis elegans epidermal growth factor receptorpathway substrate 8 splice variant A protein. Length = 917 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 721 PPPPVVIPPPPPP 733 >AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform b protein. Length = 774 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 855 PPPPAXXPPPXPPRCRXXXXPXXXXXXXXXQLSPPT 962 PPP PPP PP P QL P T Sbjct: 102 PPPIPASPPPRPPASEPVGIPLYSEKQHQQQLRPTT 137 >AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform a protein. Length = 996 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 855 PPPPAXXPPPXPPRCRXXXXPXXXXXXXXXQLSPPT 962 PPP PPP PP P QL P T Sbjct: 324 PPPIPASPPPRPPASEPVGIPLYSEKQHQQQLRPTT 359 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 855 PPPPAXXPPPXPP 893 PPPP PPP PP Sbjct: 345 PPPPGGCPPPPPP 357 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,282,492 Number of Sequences: 27780 Number of extensions: 139560 Number of successful extensions: 3042 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2596 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2824804260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -