BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H21 (962 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 90 4e-18 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 90 4e-18 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 89 1e-17 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 89 1e-17 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 82 1e-15 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 82 1e-15 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 82 1e-15 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 79 7e-15 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 79 7e-15 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 79 7e-15 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 79 7e-15 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 71 3e-12 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 69 1e-11 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 69 1e-11 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 69 1e-11 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 68 2e-11 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 68 2e-11 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 68 2e-11 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 68 2e-11 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 68 2e-11 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 68 2e-11 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 68 2e-11 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 66 9e-11 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 66 9e-11 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 66 9e-11 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 66 9e-11 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 65 2e-10 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 65 2e-10 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 63 5e-10 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 63 5e-10 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 62 8e-10 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 62 8e-10 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 62 1e-09 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 62 1e-09 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 62 1e-09 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 62 1e-09 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 62 1e-09 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 62 1e-09 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 61 3e-09 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 60 4e-09 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 60 4e-09 AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-P... 60 4e-09 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 60 4e-09 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 60 6e-09 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 59 8e-09 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 59 8e-09 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 59 8e-09 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 59 8e-09 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 59 8e-09 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 59 8e-09 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 59 1e-08 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 59 1e-08 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 59 1e-08 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 59 1e-08 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 59 1e-08 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 59 1e-08 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 59 1e-08 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 59 1e-08 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 59 1e-08 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 58 1e-08 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 58 1e-08 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 58 2e-08 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 57 4e-08 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 56 5e-08 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 56 5e-08 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 56 7e-08 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 56 1e-07 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 56 1e-07 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 56 1e-07 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 55 1e-07 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 54 2e-07 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 54 2e-07 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 54 2e-07 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 54 2e-07 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 54 2e-07 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 54 2e-07 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 54 2e-07 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 54 2e-07 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 54 3e-07 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 54 3e-07 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 54 3e-07 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 54 4e-07 AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p pro... 54 4e-07 AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-P... 54 4e-07 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 54 4e-07 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 53 5e-07 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 53 5e-07 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 53 7e-07 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 53 7e-07 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 53 7e-07 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 53 7e-07 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 53 7e-07 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 53 7e-07 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 52 9e-07 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 52 9e-07 BT003322-1|AAO25082.1| 575|Drosophila melanogaster AT02511p pro... 52 1e-06 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 52 1e-06 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 52 1e-06 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 52 1e-06 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 52 1e-06 AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA... 52 1e-06 AE013599-2343|AAS64829.1| 575|Drosophila melanogaster CG15920-P... 52 1e-06 AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-P... 52 1e-06 BT003778-1|AAO41459.1| 278|Drosophila melanogaster RE04224p pro... 51 3e-06 AE013599-2441|AAF57885.2| 278|Drosophila melanogaster CG10953-P... 51 3e-06 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 50 4e-06 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 50 5e-06 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 50 5e-06 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 50 5e-06 AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA... 50 5e-06 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 50 6e-06 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 50 6e-06 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 50 6e-06 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 50 6e-06 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 50 6e-06 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 49 8e-06 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 49 8e-06 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 49 8e-06 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 49 8e-06 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 49 8e-06 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 49 8e-06 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 49 8e-06 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 49 1e-05 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 49 1e-05 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 49 1e-05 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 49 1e-05 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 49 1e-05 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 49 1e-05 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 49 1e-05 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 49 1e-05 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 48 1e-05 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 47 3e-05 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 47 3e-05 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 47 4e-05 BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p pro... 46 6e-05 BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p pro... 46 6e-05 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 46 6e-05 AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p pro... 46 6e-05 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 46 6e-05 AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB... 46 6e-05 AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA... 46 6e-05 AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA... 46 6e-05 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 46 8e-05 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 46 8e-05 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 46 8e-05 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 46 8e-05 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 46 1e-04 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 46 1e-04 AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p pro... 46 1e-04 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 46 1e-04 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 46 1e-04 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 46 1e-04 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 46 1e-04 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 45 1e-04 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 45 1e-04 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 45 1e-04 BT001672-1|AAN71427.1| 315|Drosophila melanogaster RE50346p pro... 45 1e-04 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 45 1e-04 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 45 1e-04 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 45 1e-04 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 45 1e-04 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 45 1e-04 BT023264-1|AAY55680.1| 154|Drosophila melanogaster IP02678p pro... 45 2e-04 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 45 2e-04 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 45 2e-04 BT001468-1|AAN71223.1| 391|Drosophila melanogaster GM32356p pro... 45 2e-04 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 45 2e-04 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 45 2e-04 AY118297-1|AAM48326.1| 659|Drosophila melanogaster GH07242p pro... 45 2e-04 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 45 2e-04 AE014298-478|AAN09091.2| 627|Drosophila melanogaster CG3588-PC,... 45 2e-04 AE014298-477|AAZ52489.1| 655|Drosophila melanogaster CG3588-PD,... 45 2e-04 AE014298-476|AAN09092.1| 655|Drosophila melanogaster CG3588-PA,... 45 2e-04 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 45 2e-04 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 45 2e-04 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 45 2e-04 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 45 2e-04 AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-P... 45 2e-04 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 44 2e-04 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 44 2e-04 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 44 2e-04 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 44 2e-04 AE014134-999|AAF52311.2| 381|Drosophila melanogaster CG9050-PA ... 44 2e-04 AY058523-1|AAL13752.1| 816|Drosophila melanogaster LD23056p pro... 44 3e-04 AJ238947-1|CAB64936.1| 496|Drosophila melanogaster heterogeneou... 44 3e-04 AF275629-1|AAF78762.1| 508|Drosophila melanogaster bancal prote... 44 3e-04 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 44 3e-04 AE014134-2030|AAF53069.1| 816|Drosophila melanogaster CG4713-PA... 44 3e-04 AE013599-3039|AAS64908.1| 315|Drosophila melanogaster CG13425-P... 44 3e-04 AE013599-3038|AAM68390.2| 413|Drosophila melanogaster CG13425-P... 44 3e-04 AE013599-3036|AAF57450.2| 496|Drosophila melanogaster CG13425-P... 44 3e-04 AE013599-3035|AAM68389.2| 502|Drosophila melanogaster CG13425-P... 44 3e-04 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 44 4e-04 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 44 4e-04 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 44 4e-04 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 44 4e-04 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 44 4e-04 X12945-1|CAA31405.1| 661|Drosophila melanogaster vasa protein. 43 5e-04 M71251-1|AAA28503.1| 159|Drosophila melanogaster EDG-91 protein. 43 5e-04 M71250-1|AAA28502.1| 159|Drosophila melanogaster EDG-91 protein. 43 5e-04 BT003569-1|AAO39573.1| 745|Drosophila melanogaster LD44990p pro... 43 5e-04 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 43 5e-04 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 43 5e-04 AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p pro... 43 5e-04 AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p pro... 43 5e-04 AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-P... 43 5e-04 AE014298-1795|AAF48187.3| 1470|Drosophila melanogaster CG17762-P... 43 5e-04 AE014298-1794|AAF48188.3| 1173|Drosophila melanogaster CG17762-P... 43 5e-04 AE014298-1793|AAF48190.3| 1173|Drosophila melanogaster CG17762-P... 43 5e-04 AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA... 43 5e-04 AE014297-2375|AAF55440.1| 159|Drosophila melanogaster CG7539-PA... 43 5e-04 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 43 5e-04 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 43 5e-04 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 43 5e-04 AE014134-2564|AAF53438.1| 661|Drosophila melanogaster CG3506-PA... 43 5e-04 AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA... 43 5e-04 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 43 7e-04 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 43 7e-04 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 43 7e-04 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 43 7e-04 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 43 7e-04 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 43 7e-04 M23560-1|AAA29013.1| 648|Drosophila melanogaster protein ( D.me... 42 0.001 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 42 0.001 BT012310-1|AAS77435.1| 189|Drosophila melanogaster LP20693p pro... 42 0.001 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 42 0.001 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 42 0.001 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 42 0.001 AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH0604... 42 0.001 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 42 0.001 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 42 0.001 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 42 0.001 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 42 0.001 AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA... 42 0.001 M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. 42 0.001 BT003516-1|AAO39520.1| 153|Drosophila melanogaster RE25364p pro... 42 0.001 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 42 0.001 AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p pro... 42 0.001 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 42 0.001 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 42 0.001 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 42 0.001 AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB... 42 0.001 AE014297-2377|AAF55442.2| 153|Drosophila melanogaster CG14327-P... 42 0.001 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 42 0.001 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 42 0.001 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 42 0.001 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 42 0.002 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 42 0.002 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 42 0.002 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 42 0.002 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 42 0.002 AE014298-2794|AAF48911.1| 668|Drosophila melanogaster CG14190-P... 42 0.002 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 42 0.002 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 42 0.002 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 42 0.002 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 42 0.002 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 42 0.002 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 41 0.002 M25545-4|AAA28621.1| 361|Drosophila melanogaster protein ( D.me... 41 0.002 M25545-3|AAA28624.1| 365|Drosophila melanogaster protein ( D.me... 41 0.002 M25545-2|AAA28623.1| 360|Drosophila melanogaster protein ( D.me... 41 0.002 M25545-1|AAA28622.1| 364|Drosophila melanogaster protein ( D.me... 41 0.002 M15766-1|AAA70426.1| 365|Drosophila melanogaster unknown protei... 41 0.002 DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr... 41 0.002 DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p... 41 0.002 AY071379-1|AAL49001.1| 288|Drosophila melanogaster RE40518p pro... 41 0.002 AY069304-1|AAL39449.1| 587|Drosophila melanogaster HL07962p pro... 41 0.002 AY061448-1|AAL28996.1| 361|Drosophila melanogaster LD38464p pro... 41 0.002 AF142631-1|AAF00596.1| 490|Drosophila melanogaster hnRNP K prot... 41 0.002 AE014298-1675|AAF48083.2| 587|Drosophila melanogaster CG1841-PB... 41 0.002 AE014298-1674|AAN09296.1| 587|Drosophila melanogaster CG1841-PA... 41 0.002 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 41 0.002 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 41 0.002 AE014297-4248|AAN14144.1| 361|Drosophila melanogaster CG9983-PF... 41 0.002 AE014297-4247|AAN14143.1| 361|Drosophila melanogaster CG9983-PD... 41 0.002 AE014297-4246|AAN14142.1| 365|Drosophila melanogaster CG9983-PC... 41 0.002 AE014297-4245|AAF56801.1| 365|Drosophila melanogaster CG9983-PB... 41 0.002 AE014297-4244|AAN14141.1| 360|Drosophila melanogaster CG9983-PE... 41 0.002 AE014297-4243|AAF56800.2| 364|Drosophila melanogaster CG9983-PA... 41 0.002 AE014297-3967|AAF56600.1| 288|Drosophila melanogaster CG5468-PA... 41 0.002 AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB... 41 0.002 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 41 0.003 BT001726-1|AAN71481.1| 440|Drosophila melanogaster RE69884p pro... 41 0.003 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 41 0.003 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 41 0.003 AY094834-1|AAM11187.1| 342|Drosophila melanogaster LD42296p pro... 41 0.003 AY075314-1|AAL68181.1| 474|Drosophila melanogaster GH04404p pro... 41 0.003 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 41 0.003 AE014297-1444|AAF54744.1| 474|Drosophila melanogaster CG31358-P... 41 0.003 AE013599-3979|AAF47289.2| 342|Drosophila melanogaster CG9083-PA... 41 0.003 AE013599-1671|AAF58402.1| 440|Drosophila melanogaster CG4663-PA... 41 0.003 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 41 0.003 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 39 0.004 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 39 0.004 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 39 0.004 AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC... 39 0.004 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 40 0.004 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 40 0.004 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 40 0.004 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 40 0.004 AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein ... 40 0.004 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 40 0.004 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 40 0.004 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 40 0.004 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 40 0.004 X12836-1|CAA31321.1| 463|Drosophila melanogaster K10 protein pr... 40 0.005 BT001885-1|AAN71659.1| 359|Drosophila melanogaster SD14463p pro... 40 0.005 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 40 0.005 AY089465-1|AAL90203.1| 586|Drosophila melanogaster AT27789p pro... 40 0.005 AY060632-1|AAL28180.1| 1335|Drosophila melanogaster GH04942p pro... 40 0.005 AL023874-7|CAA19643.1| 552|Drosophila melanogaster EG:100G10.1 ... 40 0.005 AJ270939-1|CAC20094.1| 1335|Drosophila melanogaster Nahoda prote... 40 0.005 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 40 0.005 AE014298-449|AAF45812.1| 552|Drosophila melanogaster CG2685-PA ... 40 0.005 AE014297-1387|AAF54705.1| 586|Drosophila melanogaster CG6946-PB... 40 0.005 AE014297-1386|AAF54704.1| 586|Drosophila melanogaster CG6946-PA... 40 0.005 AE014296-3128|AAF49173.1| 224|Drosophila melanogaster CG14089-P... 40 0.005 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 40 0.005 AE013599-3502|AAN16114.1| 1335|Drosophila melanogaster CG12781-P... 40 0.005 AE013599-3501|AAF46927.2| 1335|Drosophila melanogaster CG12781-P... 40 0.005 X55902-1|CAA39395.1| 700|Drosophila melanogaster Bj6 protein pr... 40 0.007 M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless prote... 40 0.007 M33496-2|AAA03215.1| 698|Drosophila melanogaster protein ( D.me... 40 0.007 M33496-1|AAA03214.1| 700|Drosophila melanogaster protein ( D.me... 40 0.007 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 40 0.007 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 40 0.007 BT010267-1|AAQ23585.1| 936|Drosophila melanogaster RE21725p pro... 40 0.007 BT003785-1|AAO41468.1| 936|Drosophila melanogaster LD44547p pro... 40 0.007 AY119651-1|AAM50305.1| 700|Drosophila melanogaster RE58280p pro... 40 0.007 AE014298-3099|AAN09667.1| 388|Drosophila melanogaster CG32521-P... 40 0.007 AE014298-3098|AAF50844.2| 388|Drosophila melanogaster CG32521-P... 40 0.007 AE014298-2380|AAX52501.1| 698|Drosophila melanogaster CG4211-PC... 40 0.007 AE014298-2379|AAF48597.2| 700|Drosophila melanogaster CG4211-PA... 40 0.007 AE014298-2378|AAN09398.1| 742|Drosophila melanogaster CG4211-PB... 40 0.007 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 40 0.007 AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-P... 40 0.007 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 40 0.007 AE013599-124|AAM68335.1| 936|Drosophila melanogaster CG11680-PC... 40 0.007 AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA... 40 0.007 AY119139-1|AAM50999.1| 615|Drosophila melanogaster RE41430p pro... 39 0.009 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 39 0.009 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 39 0.009 AE014298-1781|AAF48174.1| 264|Drosophila melanogaster CG11138-P... 39 0.009 AE014298-1780|AAF48175.2| 615|Drosophila melanogaster CG11138-P... 39 0.009 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 39 0.009 BT025960-1|ABG02204.1| 433|Drosophila melanogaster IP16063p pro... 39 0.012 AY071177-1|AAL48799.1| 212|Drosophila melanogaster RE23041p pro... 39 0.012 AY051482-1|AAK92906.1| 497|Drosophila melanogaster GH14349p pro... 39 0.012 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 39 0.012 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 39 0.012 AE014296-2840|AAF49390.3| 497|Drosophila melanogaster CG9665-PA... 39 0.012 AE014134-1927|AAF52987.1| 103|Drosophila melanogaster CG17105-P... 39 0.012 AE013599-2046|AAF58146.2| 212|Drosophila melanogaster CG8160-PA... 39 0.012 X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein pr... 38 0.016 U62542-1|AAB05771.1| 901|Drosophila melanogaster dead ringer pr... 38 0.016 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 38 0.016 U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro... 38 0.016 M23222-1|AAA28541.1| 1110|Drosophila melanogaster fsh protein. 38 0.016 BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p pro... 38 0.016 BT015270-1|AAT94499.1| 1110|Drosophila melanogaster LD26482p pro... 38 0.016 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 38 0.016 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 38 0.016 BT009991-1|AAQ22460.1| 1071|Drosophila melanogaster RE39441p pro... 38 0.016 BT001775-1|AAN71530.1| 480|Drosophila melanogaster RH13835p pro... 38 0.016 AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p pro... 38 0.016 AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p pro... 38 0.016 AY118625-1|AAM49994.1| 177|Drosophila melanogaster RE24635p pro... 38 0.016 AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro... 38 0.016 AY071218-1|AAL48840.1| 88|Drosophila melanogaster RE26296p pro... 38 0.016 AY069682-1|AAL39827.1| 1332|Drosophila melanogaster LD45430p pro... 38 0.016 AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein... 38 0.016 AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p... 38 0.016 AF276964-1|AAO23023.1| 1375|Drosophila melanogaster lingerer pro... 38 0.016 AF276963-1|AAO23022.1| 1332|Drosophila melanogaster lingerer pro... 38 0.016 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 38 0.016 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 38 0.016 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 38 0.016 AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA... 38 0.016 AE014298-2404|AAF48609.1| 511|Drosophila melanogaster CG9968-PB... 38 0.016 AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P... 38 0.016 AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P... 38 0.016 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 38 0.016 AE014298-1111|AAS65279.1| 1110|Drosophila melanogaster CG2252-PE... 38 0.016 AE014298-1110|AAS65278.1| 1110|Drosophila melanogaster CG2252-PD... 38 0.016 AE014298-1109|AAS65277.1| 1110|Drosophila melanogaster CG2252-PC... 38 0.016 AE014298-1108|AAN09226.1| 1110|Drosophila melanogaster CG2252-PA... 38 0.016 AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA,... 38 0.016 AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,... 38 0.016 AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,... 38 0.016 AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,... 38 0.016 AE014297-3530|AAF56285.2| 457|Drosophila melanogaster CG5746-PB... 38 0.016 AE014297-3529|AAF56284.2| 457|Drosophila melanogaster CG5746-PA... 38 0.016 AE014296-2068|AAF49980.2| 1713|Drosophila melanogaster CG5700-PB... 38 0.016 AE014134-1929|AAF52989.1| 177|Drosophila melanogaster CG7299-PA... 38 0.016 AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-P... 38 0.016 AE013599-3541|AAF46954.1| 88|Drosophila melanogaster CG9877-PA... 38 0.016 AE013599-1467|AAF58524.2| 259|Drosophila melanogaster CG30042-P... 38 0.016 AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-P... 38 0.016 AE013599-579|AAX52724.1| 1375|Drosophila melanogaster CG8715-PD,... 38 0.016 AE013599-578|AAF59144.3| 1332|Drosophila melanogaster CG8715-PB,... 38 0.016 AE013599-577|AAS64895.2| 1343|Drosophila melanogaster CG8715-PC,... 38 0.016 AE013599-576|AAM68848.2| 1343|Drosophila melanogaster CG8715-PA,... 38 0.016 AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein... 38 0.016 AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein... 38 0.016 AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein... 38 0.016 AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein... 38 0.016 BT024219-1|ABC86281.1| 484|Drosophila melanogaster RE09672p pro... 38 0.021 BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p pro... 38 0.021 BT003608-1|AAO39611.1| 377|Drosophila melanogaster GH19274p pro... 38 0.021 BT003318-1|AAO25078.1| 517|Drosophila melanogaster AT26991p pro... 38 0.021 BT001317-1|AAN71072.1| 517|Drosophila melanogaster AT15066p pro... 38 0.021 AY118880-1|AAM50740.1| 388|Drosophila melanogaster HL01222p pro... 38 0.021 AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-P... 38 0.021 AE014298-2104|AAF48424.1| 2075|Drosophila melanogaster CG5627-PA... 38 0.021 AE014298-1194|AAF46386.3| 1195|Drosophila melanogaster CG11219-P... 38 0.021 AE014298-893|AAF46164.3| 483|Drosophila melanogaster CG3367-PA ... 38 0.021 AE014297-2648|AAF55656.1| 555|Drosophila melanogaster CG14280-P... 38 0.021 AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-P... 38 0.021 AE014296-204|AAN11465.1| 517|Drosophila melanogaster CG9130-PB,... 38 0.021 AE014296-203|AAN11464.1| 517|Drosophila melanogaster CG9130-PA,... 38 0.021 DQ231608-1|ABA71714.1| 415|Drosophila melanogaster male accesso... 38 0.027 BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro... 38 0.027 BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro... 38 0.027 BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro... 38 0.027 BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro... 38 0.027 BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro... 38 0.027 AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p pro... 38 0.027 AY070499-1|AAL47970.1| 428|Drosophila melanogaster GH07841p pro... 38 0.027 AF203342-1|AAF13280.1| 1729|Drosophila melanogaster pericardine ... 38 0.027 AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791... 38 0.027 AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD... 38 0.027 AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC... 38 0.027 AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA... 38 0.027 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 38 0.027 AE014134-758|ABI31286.1| 415|Drosophila melanogaster CG34102-PA... 38 0.027 AE013599-3650|AAF47037.3| 906|Drosophila melanogaster CG5403-PA... 38 0.027 AE013599-3649|AAO41347.1| 911|Drosophila melanogaster CG5403-PB... 38 0.027 AE013599-1819|AAS64855.1| 433|Drosophila melanogaster CG8118-PC... 38 0.027 AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB... 38 0.027 AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA... 38 0.027 AE013599-1493|AAM68686.1| 130|Drosophila melanogaster CG30334-P... 38 0.027 AE013599-1058|AAF58816.2| 2376|Drosophila melanogaster CG18408-P... 38 0.027 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 38 0.027 AB053478-1|BAB62017.1| 2376|Drosophila melanogaster DCAPL1 protein. 38 0.027 M16599-1|AAA28912.1| 590|Drosophila melanogaster protein ( D.me... 37 0.036 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 37 0.036 BT011183-1|AAR88544.1| 603|Drosophila melanogaster RE17878p pro... 37 0.036 AY128441-1|AAM75034.1| 786|Drosophila melanogaster LD16208p pro... 37 0.036 AY113357-1|AAM29362.1| 445|Drosophila melanogaster GM14473p pro... 37 0.036 AY069457-1|AAL39602.1| 603|Drosophila melanogaster LD18251p pro... 37 0.036 AF314193-1|AAK00302.1| 3109|Drosophila melanogaster Toutatis pro... 37 0.036 AF044337-1|AAB99858.1| 588|Drosophila melanogaster TEC29 protein. 37 0.036 AE014298-1977|AAF48333.2| 1103|Drosophila melanogaster CG32611-P... 37 0.036 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 37 0.036 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 37 0.036 AE014297-2460|AAN13763.1| 445|Drosophila melanogaster CG7187-PC... 37 0.036 AE014297-2459|AAN13762.1| 445|Drosophila melanogaster CG7187-PB... 37 0.036 AE014297-2458|AAF55508.1| 445|Drosophila melanogaster CG7187-PA... 37 0.036 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 37 0.036 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 37 0.036 AE014134-1451|AAN11162.1| 603|Drosophila melanogaster CG8049-PC... 37 0.036 AE014134-1450|AAF52631.3| 603|Drosophila melanogaster CG8049-PA... 37 0.036 AE014134-1449|AAN11161.1| 786|Drosophila melanogaster CG8049-PD... 37 0.036 AE014134-1448|AAF52632.2| 786|Drosophila melanogaster CG8049-PB... 37 0.036 AE013599-1322|AAF58638.2| 3080|Drosophila melanogaster CG10897-P... 37 0.036 AB235207-1|BAF31332.1| 1089|Drosophila melanogaster CG32611 prot... 37 0.036 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 90.2 bits (214), Expect = 4e-18 Identities = 59/158 (37%), Positives = 60/158 (37%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGX-GXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 215 GGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGA- 273 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--X 610 G G G G GG G G PGGGG GG G G GGG G G Sbjct: 274 -----GGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPG 328 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGG-XXPXXGGAXXGG 499 G G GG G G G GG G GG P G+ GG Sbjct: 329 GGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGG 366 Score = 88.2 bits (209), Expect = 1e-17 Identities = 56/156 (35%), Positives = 58/156 (37%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GGGG +G G G+G GG G GG Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGG--GGAGGGSGGGGGGAGGGGGYGSGGGSG 218 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGG-GXGGXXXGXG-XAGGGXGGXXXXXXGXG 607 G G G G G GG GG GGG G GG G G GGG GG G G Sbjct: 219 RGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYG 278 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G G GG GG GG Sbjct: 279 GGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 314 Score = 83.0 bits (196), Expect = 6e-16 Identities = 58/165 (35%), Positives = 58/165 (35%), Gaps = 11/165 (6%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 313 GGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQG 372 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG-----GXGGXXXXX 619 G G G G GG GG GGGG G G G A G G GG Sbjct: 373 GGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 432 Query: 618 XGXGXGXGGXXGXGXXXXGX----GGAGXGGG-XXPXXGGAXXGG 499 G G G GG G G GG G GGG P G GG Sbjct: 433 GGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGG 477 Score = 81.8 bits (193), Expect = 1e-15 Identities = 56/157 (35%), Positives = 57/157 (36%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGX--GXGGXXXXXXXXXXXXXXXXXXX 787 GG G G GG GGGG G G GAG GG G GG Sbjct: 224 GGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGG 283 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-XAGGGXGGXXXXXXGX 610 GA G G G GG GG G GGGG GG G GGG GG G Sbjct: 284 GRGGGGAPGAPGSPGGGGFGGQGGGGGFG-GGGGRGGAPGAPGSPGGGGYGGQGGAGGGY 342 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G+ GGG GG GG Sbjct: 343 GGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGG 379 Score = 77.8 bits (183), Expect = 2e-14 Identities = 55/158 (34%), Positives = 56/158 (35%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 248 GGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQG- 306 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 G G G G GG G G PGGGG GG G GGG G G Sbjct: 307 -------GGGGFGGGGGRGGAPGAP-GSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPG 358 Query: 603 GXGGXXGXGXXXXGXG---GAGXGGGXXPXXGGAXXGG 499 G G G G G G G G G P G+ GG Sbjct: 359 APGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGG 396 Score = 74.1 bits (174), Expect = 3e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 6/159 (3%) Frame = -3 Query: 960 GGXGRGGXG-----GXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXX 796 GG GRGG G G GGGG G G G G GG G G GG Sbjct: 344 GGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGG--GGGRGGAPGAPGSPGGGGFGGQ 401 Query: 795 XXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG-XXXXX 619 G G G G GG GG GGGG G G G AGG GG Sbjct: 402 GGGGGY---GGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGG 458 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G G GG G G G G G P GG G Sbjct: 459 PGYGGGAGGPGGAGGRPGGPGLPG-NQYVPPAAGGGAPG 496 Score = 71.7 bits (168), Expect = 1e-12 Identities = 51/155 (32%), Positives = 51/155 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G GG G GG G GG GG GGGG GGGG G Sbjct: 163 GYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGA 222 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G G GG GG G G Sbjct: 223 PGGPGAPGGGGFGGQGGGGG--YGGAGGGAGRGGSPGGPGSPGGGGFGG-QGGAGGGYGG 279 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG GG G G G GGGG G G GG Sbjct: 280 GGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 314 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/155 (31%), Positives = 51/155 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G G GGG GG GGGG G GGG G Sbjct: 202 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGS 261 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G+GG GG G G Sbjct: 262 PGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGG----GGGR 317 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG G G GG G+GG G G G GG Sbjct: 318 GGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGG 352 Score = 64.5 bits (150), Expect = 2e-10 Identities = 40/94 (42%), Positives = 40/94 (42%), Gaps = 4/94 (4%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGG---XGGXXXGXGXAGGG-XGGXXXXXXGXGXG 601 A G G G GG G GG GGGG GG G G AGGG GG G G G Sbjct: 153 AQGISILPGGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYG 212 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G G G GGG GG GG Sbjct: 213 SGGGSGRGGAPGGPGAPG-GGGFGGQGGGGGYGG 245 Score = 60.1 bits (139), Expect = 4e-09 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 2/115 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GGG G GG G G Sbjct: 365 GGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPG 424 Query: 670 XXGXXGGGGXGGXXXGGG--GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G GG GG GGG GAGG G G G GGG GG GG G G Sbjct: 425 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPG 479 Score = 59.7 bits (138), Expect = 6e-09 Identities = 44/154 (28%), Positives = 45/154 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G GG GGGG G G G G G GG Sbjct: 358 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAP 417 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G+ G G G G GG G G G GG G G G G G G G Sbjct: 418 GAPGSPGGGGFGGQGGGGGFGAGG-GRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPG 476 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G P GG G Sbjct: 477 GPGLPGNQYVPPAAGGGAPGSPGRPGSGGVPGTG 510 Score = 57.6 bits (133), Expect = 2e-08 Identities = 47/151 (31%), Positives = 47/151 (31%), Gaps = 9/151 (5%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGX---------GGXXXXXXXXXXXX 808 GG GRGG G GGGG G G G G GG G G GG Sbjct: 379 GGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFG 438 Query: 807 XXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXX 628 G G G G G GG G PGG G G AGGG G Sbjct: 439 AGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSP 498 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G GGG Sbjct: 499 GR-----PGSGGVPGTGSQYIPPAPGAPGGG 524 Score = 45.6 bits (103), Expect = 1e-04 Identities = 36/128 (28%), Positives = 37/128 (28%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GRGG G GGGG G G G G G G G G Sbjct: 409 GGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGG---- 464 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 A G G G G G P GG G +GG G Sbjct: 465 ----AGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGRPGSGGVPGTGSQYIPPAPGA 520 Query: 600 XGGXXGXG 577 GG G G Sbjct: 521 PGGGRGNG 528 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G GGPGGGG GG G GG G G G G G Sbjct: 1 GFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 40 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGG 557 G GGGG GG G G GG G G G GGG Sbjct: 4 GGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 40 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 652 GGGXGGXXXGG-GGAGGGXGXXXXXGAXGXGGGXGGXG 542 GGG GG GG GG G G GGG GG G Sbjct: 3 GGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 40 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 646 GXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGG 536 G GG GGG G G G G A G GG GGG Sbjct: 1 GFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 38 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 G GG GGGG G GGG G Sbjct: 1 GFGGGPGGGGAGGFGGGNNG 20 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG G GG G G GG Sbjct: 3 GGGPGGGGAGGFGGGNNGLGG 23 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG G G G G G G G G GGG P + GG Sbjct: 3 GGGPGGGGAG-------GFGGGNNGLGGFANGRPIAPGGGGGGGGAPAPRPSPSGG 51 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 90.2 bits (214), Expect = 4e-18 Identities = 59/158 (37%), Positives = 60/158 (37%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGX-GXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 287 GGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGA- 345 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--X 610 G G G G GG G G PGGGG GG G G GGG G G Sbjct: 346 -----GGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPG 400 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGG-XXPXXGGAXXGG 499 G G GG G G G GG G GG P G+ GG Sbjct: 401 GGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGG 438 Score = 88.2 bits (209), Expect = 1e-17 Identities = 56/156 (35%), Positives = 58/156 (37%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GGGG +G G G+G GG G GG Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGG--GGAGGGSGGGGGGAGGGGGYGSGGGSG 290 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGG-GXGGXXXGXG-XAGGGXGGXXXXXXGXG 607 G G G G G GG GG GGG G GG G G GGG GG G G Sbjct: 291 RGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYG 350 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G G GG GG GG Sbjct: 351 GGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 386 Score = 83.0 bits (196), Expect = 6e-16 Identities = 58/165 (35%), Positives = 58/165 (35%), Gaps = 11/165 (6%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 385 GGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQG 444 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG-----GXGGXXXXX 619 G G G G GG GG GGGG G G G A G G GG Sbjct: 445 GGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 504 Query: 618 XGXGXGXGGXXGXGXXXXGX----GGAGXGGG-XXPXXGGAXXGG 499 G G G GG G G GG G GGG P G GG Sbjct: 505 GGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGG 549 Score = 81.8 bits (193), Expect = 1e-15 Identities = 56/157 (35%), Positives = 57/157 (36%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGX--GXGGXXXXXXXXXXXXXXXXXXX 787 GG G G GG GGGG G G GAG GG G GG Sbjct: 296 GGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGG 355 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-XAGGGXGGXXXXXXGX 610 GA G G G GG GG G GGGG GG G GGG GG G Sbjct: 356 GRGGGGAPGAPGSPGGGGFGGQGGGGGFG-GGGGRGGAPGAPGSPGGGGYGGQGGAGGGY 414 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G+ GGG GG GG Sbjct: 415 GGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGG 451 Score = 77.8 bits (183), Expect = 2e-14 Identities = 55/158 (34%), Positives = 56/158 (35%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GRGG G GGGG G G G G GG G G GG Sbjct: 320 GGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQG- 378 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 G G G G GG G G PGGGG GG G GGG G G Sbjct: 379 -------GGGGFGGGGGRGGAPGAP-GSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPG 430 Query: 603 GXGGXXGXGXXXXGXG---GAGXGGGXXPXXGGAXXGG 499 G G G G G G G G G P G+ GG Sbjct: 431 APGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGG 468 Score = 74.1 bits (174), Expect = 3e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 6/159 (3%) Frame = -3 Query: 960 GGXGRGGXG-----GXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXX 796 GG GRGG G G GGGG G G G G GG G G GG Sbjct: 416 GGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGG--GGGRGGAPGAPGSPGGGGFGGQ 473 Query: 795 XXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG-XXXXX 619 G G G G GG GG GGGG G G G AGG GG Sbjct: 474 GGGGGY---GGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGG 530 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G G GG G G G G G P GG G Sbjct: 531 PGYGGGAGGPGGAGGRPGGPGLPG-NQYVPPAAGGGAPG 568 Score = 71.7 bits (168), Expect = 1e-12 Identities = 51/155 (32%), Positives = 51/155 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G GG G GG G GG GG GGGG GGGG G Sbjct: 235 GYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGA 294 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G G GG GG G G Sbjct: 295 PGGPGAPGGGGFGGQGGGGG--YGGAGGGAGRGGSPGGPGSPGGGGFGG-QGGAGGGYGG 351 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG GG G G G GGGG G G GG Sbjct: 352 GGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 386 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/155 (31%), Positives = 51/155 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G G GGG GG GGGG G GGG G Sbjct: 274 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGS 333 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G+GG GG G G Sbjct: 334 PGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGG----GGGR 389 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG G G GG G+GG G G G GG Sbjct: 390 GGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGG 424 Score = 64.5 bits (150), Expect = 2e-10 Identities = 40/94 (42%), Positives = 40/94 (42%), Gaps = 4/94 (4%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGG---XGGXXXGXGXAGGG-XGGXXXXXXGXGXG 601 A G G G GG G GG GGGG GG G G AGGG GG G G G Sbjct: 225 AQGISILPGGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYG 284 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G G G GGG GG GG Sbjct: 285 SGGGSGRGGAPGGPGAPG-GGGFGGQGGGGGYGG 317 Score = 60.1 bits (139), Expect = 4e-09 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 2/115 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GGG G GG G G Sbjct: 437 GGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPG 496 Query: 670 XXGXXGGGGXGGXXXGGG--GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G GG GG GGG GAGG G G G GGG GG GG G G Sbjct: 497 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPG 551 Score = 59.7 bits (138), Expect = 6e-09 Identities = 44/154 (28%), Positives = 45/154 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G GG GGGG G G G G G GG Sbjct: 430 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAP 489 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G+ G G G G GG G G G GG G G G G G G G Sbjct: 490 GAPGSPGGGGFGGQGGGGGFGAGG-GRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPG 548 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G P GG G Sbjct: 549 GPGLPGNQYVPPAAGGGAPGSPGRPGSGGVPGTG 582 Score = 57.6 bits (133), Expect = 2e-08 Identities = 31/79 (39%), Positives = 31/79 (39%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGGG G G GGG GG G G G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGL 93 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG G P GG G Sbjct: 94 GGFANGRPIAPGGGGGGGG 112 Score = 57.6 bits (133), Expect = 2e-08 Identities = 47/151 (31%), Positives = 47/151 (31%), Gaps = 9/151 (5%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGX---------GGXXXXXXXXXXXX 808 GG GRGG G GGGG G G G G GG G G GG Sbjct: 451 GGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFG 510 Query: 807 XXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXX 628 G G G G G GG G PGG G G AGGG G Sbjct: 511 AGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSP 570 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G GGG Sbjct: 571 GR-----PGSGGVPGTGSQYIPPAPGAPGGG 596 Score = 54.4 bits (125), Expect = 2e-07 Identities = 34/88 (38%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGGG G G G GGG G G G G G G Sbjct: 44 GGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGG-GPGGGGAG-------GFGGGNNGLGG 95 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG P + GG Sbjct: 96 FANGRPIAPGGGGGGGGAPAPRPSPSGG 123 Score = 52.4 bits (120), Expect = 9e-07 Identities = 31/73 (42%), Positives = 31/73 (42%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GPGGG GG G G AGGG GG G G G G G G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGG--------GGGGGPAGGFGGGPGGGGAG 84 Query: 549 GXGGGXXPXXGGA 511 G GGG G A Sbjct: 85 GFGGGNNGLGGFA 97 Score = 45.6 bits (103), Expect = 1e-04 Identities = 36/128 (28%), Positives = 37/128 (28%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GRGG G GGGG G G G G G G G G Sbjct: 481 GGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGG---- 536 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 A G G G G G P GG G +GG G Sbjct: 537 ----AGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGRPGSGGVPGTGSQYIPPAPGA 592 Query: 600 XGGXXGXG 577 GG G G Sbjct: 593 PGGGRGNG 600 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GG GG GGGG G GGG G Sbjct: 44 GGGFGGGG-GFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNG 92 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG GGGGAGGG G GGG GG GG G G G Sbjct: 44 GGGFGGGGGFGGGGAGGGYG----------GGGGGGPAGGFGGGPGGGGAGG 85 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 654 AGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 + GG G G G G GG G G G GG G GG GG GG Sbjct: 31 SAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGG 82 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GG G GGG GGG G G G GGG GG GGG Sbjct: 33 GGSPGAGLQGPGGGFGGGGG----FGGGGAGGGYGGGGGG 68 Score = 38.7 bits (86), Expect = 0.012 Identities = 32/95 (33%), Positives = 32/95 (33%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G G GGGG G G G G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAG---------------GFGGGP 78 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGG 676 GA G G G GG G PGGGG GG Sbjct: 79 GGGGAGGFG--GGNNGLGGFANGRPIAPGGGGGGG 111 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G+ G G G G GGG GG GGGG G GGG G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPG 79 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GAG G G GG G GGG GG GG G GGGG G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYG--GGGGGGPAGGFGGGPGGGGAG 84 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G GGG GG G GG G G GG Sbjct: 46 GFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGG 95 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G G G GGG G GGG G GG G Sbjct: 50 GGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANG 99 Score = 35.9 bits (79), Expect = 0.083 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG GG G G GG G GGGGGG Sbjct: 61 GYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 962 GAGXGAGGXGXGGX-GXXXXXXXXXXXXRXGGGXGGXGGGGXX-----GXGGGGGG 813 GAG G GG G GG G GGG G GG G GGGGGG Sbjct: 57 GAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 112 Score = 35.1 bits (77), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GGG G G G G GGG G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 30.3 bits (65), Expect = 4.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 A G G G G G G G GGGG GG GGG Sbjct: 29 AASAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGG 77 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 88.6 bits (210), Expect = 1e-17 Identities = 53/157 (33%), Positives = 54/157 (34%), Gaps = 4/157 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXP---PPAXPXP 667 PP PP PPP P PP P P PP P P P PP P PP P P Sbjct: 70 PPQTRPPPP--PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP P P P P PP P P P P Sbjct: 128 RP-PPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQ 186 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P P+ P PP PP PPRP P Sbjct: 187 PGPEYLPPDQPKPRPTPSRPQPP-----PPPPPRPQP 218 Score = 87.0 bits (206), Expect = 3e-17 Identities = 51/157 (32%), Positives = 52/157 (33%), Gaps = 3/157 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P APP PP P P P P P PP P PP P P+ P P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 677 PPXPPPPGPPXXPPXXPPXXPXP-XXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX 853 PP P PP P PP P P P P PP Sbjct: 169 PPQPQPPAP--QPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPP 226 Query: 854 PXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRPXPP 961 P P P P P P PPP P P PPRP PP Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Score = 85.0 bits (201), Expect = 1e-16 Identities = 55/162 (33%), Positives = 56/162 (34%), Gaps = 9/162 (5%) Frame = +2 Query: 500 PPXXAPPXXGXX--PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP P G PP P P P P P P PP P P P PP PP P P Sbjct: 179 PPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPG 238 Query: 671 XXPPXPPP-PGPPXXPPXXP-PXXPXP-XXXPXPXA-XXXXXXXXXXXXXXXXXXXXXXX 838 PP PPP PGP P P P P P P P + Sbjct: 239 YGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPE 298 Query: 839 XXPPXPXPXXPP--XPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PA P P PP PP P P Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAP 340 Score = 83.4 bits (197), Expect = 4e-16 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 3/156 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P + P PP PP P P P P P P PP PPP P P P Sbjct: 59 PAPSAPAPSYGPPQTRPPPPPPPPQPTP---PAPRPSYGPPQTQPPRPPPQ-PTPSAPAP 114 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PP GPP PP PP P P P + PP P P Sbjct: 115 PPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQP 174 Query: 863 XXPPXPAPXPXPAXPP---PPXXXXXPPXPPRPXPP 961 P P+P P P P PP P P RP PP Sbjct: 175 PAPQPPSP-PSPQPGPEYLPPDQPKPRPTPSRPQPP 209 Score = 82.2 bits (194), Expect = 1e-15 Identities = 48/158 (30%), Positives = 48/158 (30%), Gaps = 4/158 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P G PPP P PP P P P P P PP P P P P Sbjct: 212 PPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQ 271 Query: 680 PXP---PPPGPPXXPPXXP-PXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 P PPPG P P P P P P P A Sbjct: 272 PGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPR 331 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P P PP P P PP P P Sbjct: 332 PPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAP 369 Score = 80.6 bits (190), Expect = 3e-15 Identities = 48/154 (31%), Positives = 49/154 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P P P PP P P P PP P P P P P P P P Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRP--QP 208 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P PPPP P P PP P P P P PP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPP---PKP----QPTPGYGPPTPPPGPGPAQPAPQPPRPQ 261 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P PPP P P+P P Sbjct: 262 PPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAP 295 Score = 80.2 bits (189), Expect = 4e-15 Identities = 48/155 (30%), Positives = 49/155 (31%), Gaps = 2/155 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP PPP P PP P P P P P PP P P+ P P Sbjct: 66 PSYGPPQT--RPPPPPPPPQPTPPAPRPSYGPPQTQPPRP----PPQPTPSAPAPPPPSY 119 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PP PP PP P P P P PP P P Sbjct: 120 GPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQP 179 Query: 863 XXPPXPAPXP--XPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P P PP P PP Sbjct: 180 PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPP 214 Score = 77.4 bits (182), Expect = 3e-14 Identities = 52/167 (31%), Positives = 52/167 (31%), Gaps = 14/167 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXP----XPXXPPXPXPXPXXXXXXPPXPPPAXPX 664 P AP P PP P PP P P P P P P P PP PP P Sbjct: 160 PSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPT 219 Query: 665 PXXXPPXPPPP---------GPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXX 817 P PP PPPP GPP PP P P P P Sbjct: 220 PGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAP--QPPRPQPPRPQPPRPQPGSEYL 277 Query: 818 XXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P PA P P PP PP P P Sbjct: 278 PPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAP 324 Score = 74.5 bits (175), Expect = 2e-13 Identities = 50/166 (30%), Positives = 50/166 (30%), Gaps = 12/166 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPP-----PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPA 655 PP P G PP P PA P P P P P P P P PP P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPT 288 Query: 656 XPXPXXXPPX--PPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXX 829 P P P PPPP PP P P P P P Sbjct: 289 QPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRP 348 Query: 830 XXXXXPPXPX--PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PAP P P P P P P PP Sbjct: 349 PSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 72.1 bits (169), Expect = 1e-12 Identities = 49/165 (29%), Positives = 50/165 (30%), Gaps = 5/165 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPP-PRPXXP-PXPXPXPXPPXPPXPXPXXXXXXXPPS-- 645 P PP P P PPP P P P P P P PP P P PS Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 646 PPRPXXPXXXXXXXXXXXXXXXXXXXPXPXPGP-PXXXXXXXXXXXXXXXXXXXXXXPPP 822 PP+P P P P P P PPP Sbjct: 169 PPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPP 228 Query: 823 PPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPP P P PP PPP P PP P PP P P Sbjct: 229 PPPKPQPTPGYGPPTPPP-GPGPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 64.5 bits (150), Expect = 2e-10 Identities = 49/172 (28%), Positives = 49/172 (28%), Gaps = 20/172 (11%) Frame = +1 Query: 502 PXXXPXXXXXPXPPP-PRPXXPPXP----XPXPXPPXPPXPXPXXXXXXXPPS------- 645 P P P PPP P P P P P PP P P P PPS Sbjct: 91 PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTP 150 Query: 646 PPRPXXPXXXXXXXXXXXXXXXXXXXPXP--XPGPPXXXXXXXXXXXXXXXXXXXXXXPP 819 PPRP P P P P PP Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPP 210 Query: 820 PPPPXP------XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPP P PPPP PP P P P P P PP P P Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQP 262 Score = 58.4 bits (135), Expect = 1e-08 Identities = 39/140 (27%), Positives = 40/140 (28%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P PP P P P PP P P P P PP P P PP Sbjct: 40 PFP-PPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRP-PPPPPPPQPTPPAPRPSYGPPQ 97 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPA 901 P P P P P A P P P P P P P Sbjct: 98 TQP--PRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Query: 902 XPPPPXXXXXPPXPPRPXPP 961 P P PP+P PP Sbjct: 156 PQPTPSAPAPSYGPPQPQPP 175 Score = 55.2 bits (127), Expect = 1e-07 Identities = 41/160 (25%), Positives = 43/160 (26%), Gaps = 2/160 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXP-PSPPR 654 P PP P PP P+P P P P P P P P P+ P Sbjct: 237 PGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPV 296 Query: 655 PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX 834 P P P PGP PP PP Sbjct: 297 PEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPA 356 Query: 835 P-XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P PP PP P P P PP P P P Sbjct: 357 PTYQPQPPAPPAPAP---------GPTYQPRPPAPPAPTP 387 Score = 54.8 bits (126), Expect = 2e-07 Identities = 40/163 (24%), Positives = 42/163 (25%), Gaps = 10/163 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXX----PPXPXPXPXPPXPPXPXPXXXXXXXP------PSP 648 PP P P PPP P P P P P P PP P P P P+ Sbjct: 230 PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQ 289 Query: 649 PRPXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP 828 P+P P P P P P PP Sbjct: 290 PQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPP 349 Query: 829 PXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PP P PP P P P Sbjct: 350 SPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPP 392 Score = 52.8 bits (121), Expect = 7e-07 Identities = 33/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXP---XAPXXXXXPXPPPAPPPPXXXPPXPP--PPXXP 665 P P + PPP P PP P P P PPP P P PP P PP P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Query: 666 XXXXXXXXXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXP 845 P P PP P PP PP P Sbjct: 126 PPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Query: 846 PP 851 P Sbjct: 186 QP 187 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/68 (42%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 500 PPXXAP-PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP AP P PP PAPP P P P PP P P P PP PP P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAPPAPTYQ-PQPPAPPAPAPGPTYQPR-PPAPPA--PTPEYG 390 Query: 677 PPXPPPPG 700 PP P G Sbjct: 391 PPPPTSGG 398 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXP-----PPXPXAPXXXXXPXP-PPAPPPPXXXP---PXPPPPXXP 665 P P PP P P PP P AP P PPAPP P P P PP P P Sbjct: 295 PVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAP 354 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 88.6 bits (210), Expect = 1e-17 Identities = 53/157 (33%), Positives = 54/157 (34%), Gaps = 4/157 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXP---PPAXPXP 667 PP PP PPP P PP P P PP P P P PP P PP P P Sbjct: 70 PPQTRPPPP--PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP P P P P PP P P P P Sbjct: 128 RP-PPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQ 186 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P P+ P PP PP PPRP P Sbjct: 187 PGPEYLPPDQPKPRPTPSRPQPP-----PPPPPRPQP 218 Score = 87.0 bits (206), Expect = 3e-17 Identities = 51/157 (32%), Positives = 52/157 (33%), Gaps = 3/157 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P APP PP P P P P P PP P PP P P+ P P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 677 PPXPPPPGPPXXPPXXPPXXPXP-XXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX 853 PP P PP P PP P P P P PP Sbjct: 169 PPQPQPPAP--QPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPP 226 Query: 854 PXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRPXPP 961 P P P P P P PPP P P PPRP PP Sbjct: 227 PPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPP 263 Score = 85.0 bits (201), Expect = 1e-16 Identities = 55/162 (33%), Positives = 56/162 (34%), Gaps = 9/162 (5%) Frame = +2 Query: 500 PPXXAPPXXGXX--PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP P G PP P P P P P P PP P P P PP PP P P Sbjct: 179 PPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPG 238 Query: 671 XXPPXPPP-PGPPXXPPXXP-PXXPXP-XXXPXPXA-XXXXXXXXXXXXXXXXXXXXXXX 838 PP PPP PGP P P P P P P P + Sbjct: 239 YGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPE 298 Query: 839 XXPPXPXPXXPP--XPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PA P P PP PP P P Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAP 340 Score = 83.4 bits (197), Expect = 4e-16 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 3/156 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P + P PP PP P P P P P P PP PPP P P P Sbjct: 59 PAPSAPAPSYGPPQTRPPPPPPPPQPTP---PAPRPSYGPPQTQPPRPPPQ-PTPSAPAP 114 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PP GPP PP PP P P P + PP P P Sbjct: 115 PPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQP 174 Query: 863 XXPPXPAPXPXPAXPP---PPXXXXXPPXPPRPXPP 961 P P+P P P P PP P P RP PP Sbjct: 175 PAPQPPSP-PSPQPGPEYLPPDQPKPRPTPSRPQPP 209 Score = 82.2 bits (194), Expect = 1e-15 Identities = 48/158 (30%), Positives = 48/158 (30%), Gaps = 4/158 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P G PPP P PP P P P P P PP P P P P Sbjct: 212 PPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQ 271 Query: 680 PXP---PPPGPPXXPPXXP-PXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 P PPPG P P P P P P P A Sbjct: 272 PGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPR 331 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P P PP P P PP P P Sbjct: 332 PPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAP 369 Score = 80.6 bits (190), Expect = 3e-15 Identities = 48/154 (31%), Positives = 49/154 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P P P PP P P P PP P P P P P P P P Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRP--QP 208 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P PPPP P P PP P P P P PP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPP---PKP----QPTPGYGPPTPPPGPGPAQPAPQPPRPQ 261 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P PPP P P+P P Sbjct: 262 PPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAP 295 Score = 80.2 bits (189), Expect = 4e-15 Identities = 48/155 (30%), Positives = 49/155 (31%), Gaps = 2/155 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP PPP P PP P P P P P PP P P+ P P Sbjct: 66 PSYGPPQT--RPPPPPPPPQPTPPAPRPSYGPPQTQPPRP----PPQPTPSAPAPPPPSY 119 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PP PP PP P P P P PP P P Sbjct: 120 GPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQP 179 Query: 863 XXPPXPAPXP--XPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P P PP P PP Sbjct: 180 PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPP 214 Score = 77.4 bits (182), Expect = 3e-14 Identities = 52/167 (31%), Positives = 52/167 (31%), Gaps = 14/167 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXP----XPXXPPXPXPXPXXXXXXPPXPPPAXPX 664 P AP P PP P PP P P P P P P P PP PP P Sbjct: 160 PSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPT 219 Query: 665 PXXXPPXPPPP---------GPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXX 817 P PP PPPP GPP PP P P P P Sbjct: 220 PGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAP--QPPRPQPPRPQPPRPQPGSEYL 277 Query: 818 XXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P PA P P PP PP P P Sbjct: 278 PPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAP 324 Score = 74.5 bits (175), Expect = 2e-13 Identities = 50/166 (30%), Positives = 50/166 (30%), Gaps = 12/166 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPP-----PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPA 655 PP P G PP P PA P P P P P P P P PP P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPT 288 Query: 656 XPXPXXXPPX--PPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXX 829 P P P PPPP PP P P P P P Sbjct: 289 QPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRP 348 Query: 830 XXXXXPPXPX--PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PAP P P P P P P PP Sbjct: 349 PSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 72.1 bits (169), Expect = 1e-12 Identities = 49/165 (29%), Positives = 50/165 (30%), Gaps = 5/165 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPP-PRPXXP-PXPXPXPXPPXPPXPXPXXXXXXXPPS-- 645 P PP P P PPP P P P P P P PP P P PS Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 646 PPRPXXPXXXXXXXXXXXXXXXXXXXPXPXPGP-PXXXXXXXXXXXXXXXXXXXXXXPPP 822 PP+P P P P P P PPP Sbjct: 169 PPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPP 228 Query: 823 PPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPP P P PP PPP P PP P PP P P Sbjct: 229 PPPKPQPTPGYGPPTPPP-GPGPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 64.5 bits (150), Expect = 2e-10 Identities = 49/172 (28%), Positives = 49/172 (28%), Gaps = 20/172 (11%) Frame = +1 Query: 502 PXXXPXXXXXPXPPP-PRPXXPPXP----XPXPXPPXPPXPXPXXXXXXXPPS------- 645 P P P PPP P P P P P PP P P P PPS Sbjct: 91 PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTP 150 Query: 646 PPRPXXPXXXXXXXXXXXXXXXXXXXPXP--XPGPPXXXXXXXXXXXXXXXXXXXXXXPP 819 PPRP P P P P PP Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPP 210 Query: 820 PPPPXP------XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPP P PPPP PP P P P P P PP P P Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQP 262 Score = 58.4 bits (135), Expect = 1e-08 Identities = 39/140 (27%), Positives = 40/140 (28%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P PP P P P PP P P P P PP P P PP Sbjct: 40 PFP-PPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRP-PPPPPPPQPTPPAPRPSYGPPQ 97 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPA 901 P P P P P A P P P P P P P Sbjct: 98 TQP--PRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Query: 902 XPPPPXXXXXPPXPPRPXPP 961 P P PP+P PP Sbjct: 156 PQPTPSAPAPSYGPPQPQPP 175 Score = 55.2 bits (127), Expect = 1e-07 Identities = 41/160 (25%), Positives = 43/160 (26%), Gaps = 2/160 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXP-PSPPR 654 P PP P PP P+P P P P P P P P P+ P Sbjct: 237 PGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPV 296 Query: 655 PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX 834 P P P PGP PP PP Sbjct: 297 PEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPA 356 Query: 835 P-XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P PP PP P P P PP P P P Sbjct: 357 PTYQPQPPAPPAPAP---------GPTYQPRPPAPPAPTP 387 Score = 54.8 bits (126), Expect = 2e-07 Identities = 40/163 (24%), Positives = 42/163 (25%), Gaps = 10/163 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXX----PPXPXPXPXPPXPPXPXPXXXXXXXP------PSP 648 PP P P PPP P P P P P P PP P P P P+ Sbjct: 230 PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQ 289 Query: 649 PRPXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP 828 P+P P P P P P PP Sbjct: 290 PQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPP 349 Query: 829 PXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PP P PP P P P Sbjct: 350 SPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPP 392 Score = 52.8 bits (121), Expect = 7e-07 Identities = 33/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXP---XAPXXXXXPXPPPAPPPPXXXPPXPP--PPXXP 665 P P + PPP P PP P P P PPP P P PP P PP P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Query: 666 XXXXXXXXXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXP 845 P P PP P PP PP P Sbjct: 126 PPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Query: 846 PP 851 P Sbjct: 186 QP 187 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/68 (42%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 500 PPXXAP-PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP AP P PP PAPP P P P PP P P P PP PP P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAPPAPTYQ-PQPPAPPAPAPGPTYQPR-PPAPPA--PTPEYG 390 Query: 677 PPXPPPPG 700 PP P G Sbjct: 391 PPPPTSGG 398 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXP-----PPXPXAPXXXXXPXP-PPAPPPPXXXP---PXPPPPXXP 665 P P PP P P PP P AP P PPAPP P P P PP P P Sbjct: 295 PVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAP 354 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 81.8 bits (193), Expect = 1e-15 Identities = 49/158 (31%), Positives = 49/158 (31%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXP-----XXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P P PPP P P P P P PP P P P PP P P P Sbjct: 83 PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQP-PASPRFDPPPPHTIEPPP 141 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP PP PP P PP P P P P Sbjct: 142 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 201 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P P PPPP PP P PP Sbjct: 202 PAPAEVEPP-PPPAPTELEPPPPPAPPKVELPPPPAPP 238 Score = 71.3 bits (167), Expect = 2e-12 Identities = 47/152 (30%), Positives = 47/152 (30%), Gaps = 2/152 (1%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXXPPXP 688 AP PP PP P PP P P PP P PPA P PP Sbjct: 80 APEPVQVPAPPKVNPPPPPRPASPKVEPPPPAP---PGVESPPGPQPPASPRFDPPPPHT 136 Query: 689 -PPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 PP PP P PP P P P PP P Sbjct: 137 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKV 196 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PPPP PP P PP Sbjct: 197 EPP-PPPAPAEVEPPPPPAPTELEPPPPPAPP 227 Score = 69.7 bits (163), Expect = 6e-12 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 2/92 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX--PXPXPXXXXXXPPXPPPAXPXPXX 673 P PP PPP PAPP P P PP P P P PP PPP P P Sbjct: 127 PRFDPPPPHTIEPPPPPAPPT--LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTV 183 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 PP PPPP P P PP P P P A Sbjct: 184 EPPPPPPPAPTKVEP-PPPPAPAEVEPPPPPA 214 Score = 65.7 bits (153), Expect = 9e-11 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 10/98 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX--PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP APP PPP PAPP P P P P P P PP PPP P Sbjct: 140 PPPPAPPTL--VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVE 197 Query: 674 XPP--------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP P P PP P P P Sbjct: 198 PPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 235 Score = 64.9 bits (151), Expect = 2e-10 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP APP PPP PAPP P P P P P PPP P P Sbjct: 162 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPP 221 Query: 680 PXPPPPGPPXXPPXXPP 730 P P PP PP PP Sbjct: 222 PPPAPPKVELPPPPAPP 238 Score = 59.7 bits (138), Expect = 6e-09 Identities = 46/167 (27%), Positives = 47/167 (28%), Gaps = 7/167 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR- 654 P PP P P PP PP P P P P P P PP+PP Sbjct: 90 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAPPTL 148 Query: 655 --PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP 828 P P P P P PP PPPPP Sbjct: 149 VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPP------------------TVEPPPPPP 190 Query: 829 PXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP----XPPAPXP 957 P P PP PP P P PP P PP P P Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 237 Score = 46.4 bits (105), Expect = 6e-05 Identities = 37/133 (27%), Positives = 38/133 (28%), Gaps = 16/133 (12%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXP------PPXPXAPXXXXXPXP-PPAPP---PPXXXPPXPP 650 P P+ PP PP P PP P P P P PPA P PP PP Sbjct: 81 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 140 Query: 651 PPXXPXXXXXXXXXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPP 830 PP P P P PP P PPP Sbjct: 141 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPP 200 Query: 831 XP------PXPPP 851 P P PPP Sbjct: 201 PPAPAEVEPPPPP 213 Score = 42.7 bits (96), Expect = 7e-04 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P P PP P PP P PP P P PP+PP+ Sbjct: 181 PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPK 239 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 81.8 bits (193), Expect = 1e-15 Identities = 49/158 (31%), Positives = 49/158 (31%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXP-----XXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P P PPP P P P P P PP P P P PP P P P Sbjct: 346 PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQP-PASPRFDPPPPHTIEPPP 404 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP PP PP P PP P P P P Sbjct: 405 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P P PPPP PP P PP Sbjct: 465 PAPAEVEPP-PPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 71.3 bits (167), Expect = 2e-12 Identities = 47/152 (30%), Positives = 47/152 (30%), Gaps = 2/152 (1%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXXPPXP 688 AP PP PP P PP P P PP P PPA P PP Sbjct: 343 APEPVQVPAPPKVNPPPPPRPASPKVEPPPPAP---PGVESPPGPQPPASPRFDPPPPHT 399 Query: 689 -PPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 PP PP P PP P P P PP P Sbjct: 400 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKV 459 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PPPP PP P PP Sbjct: 460 EPP-PPPAPAEVEPPPPPAPTELEPPPPPAPP 490 Score = 69.7 bits (163), Expect = 6e-12 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 2/92 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX--PXPXPXXXXXXPPXPPPAXPXPXX 673 P PP PPP PAPP P P PP P P P PP PPP P P Sbjct: 390 PRFDPPPPHTIEPPPPPAPPT--LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTV 446 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 PP PPPP P P PP P P P A Sbjct: 447 EPPPPPPPAPTKVEP-PPPPAPAEVEPPPPPA 477 Score = 65.7 bits (153), Expect = 9e-11 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 10/98 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX--PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP APP PPP PAPP P P P P P P PP PPP P Sbjct: 403 PPPPAPPTL--VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVE 460 Query: 674 XPP--------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP P P PP P P P Sbjct: 461 PPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498 Score = 64.9 bits (151), Expect = 2e-10 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP APP PPP PAPP P P P P P PPP P P Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPP 484 Query: 680 PXPPPPGPPXXPPXXPP 730 P P PP PP PP Sbjct: 485 PPPAPPKVELPPPPAPP 501 Score = 59.7 bits (138), Expect = 6e-09 Identities = 46/167 (27%), Positives = 47/167 (28%), Gaps = 7/167 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR- 654 P PP P P PP PP P P P P P P PP+PP Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAPPTL 411 Query: 655 --PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP 828 P P P P P PP PPPPP Sbjct: 412 VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPP------------------TVEPPPPPP 453 Query: 829 PXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP----XPPAPXP 957 P P PP PP P P PP P PP P P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Score = 46.4 bits (105), Expect = 6e-05 Identities = 37/133 (27%), Positives = 38/133 (28%), Gaps = 16/133 (12%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXP------PPXPXAPXXXXXPXP-PPAPP---PPXXXPPXPP 650 P P+ PP PP P PP P P P P PPA P PP PP Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 403 Query: 651 PPXXPXXXXXXXXXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPP 830 PP P P P PP P PPP Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPP 463 Query: 831 XP------PXPPP 851 P P PPP Sbjct: 464 PPAPAEVEPPPPP 476 Score = 42.7 bits (96), Expect = 7e-04 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P P PP P PP P PP P P PP+PP+ Sbjct: 444 PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPK 502 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 81.8 bits (193), Expect = 1e-15 Identities = 49/158 (31%), Positives = 49/158 (31%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXP-----XXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P P PPP P P P P P PP P P P PP P P P Sbjct: 346 PVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQP-PASPRFDPPPPHTIEPPP 404 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP PP PP P PP P P P P Sbjct: 405 PPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPP 464 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P P PPPP PP P PP Sbjct: 465 PAPAEVEPP-PPPAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 71.3 bits (167), Expect = 2e-12 Identities = 47/152 (30%), Positives = 47/152 (30%), Gaps = 2/152 (1%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXXPPXP 688 AP PP PP P PP P P PP P PPA P PP Sbjct: 343 APEPVQVPAPPKVNPPPPPRPASPKVEPPPPAP---PGVESPPGPQPPASPRFDPPPPHT 399 Query: 689 -PPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 PP PP P PP P P P PP P Sbjct: 400 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKV 459 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PPPP PP P PP Sbjct: 460 EPP-PPPAPAEVEPPPPPAPTELEPPPPPAPP 490 Score = 69.7 bits (163), Expect = 6e-12 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 2/92 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX--PXPXPXXXXXXPPXPPPAXPXPXX 673 P PP PPP PAPP P P PP P P P PP PPP P P Sbjct: 390 PRFDPPPPHTIEPPPPPAPPT--LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTV 446 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 PP PPPP P P PP P P P A Sbjct: 447 EPPPPPPPAPTKVEP-PPPPAPAEVEPPPPPA 477 Score = 65.7 bits (153), Expect = 9e-11 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 10/98 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX--PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP APP PPP PAPP P P P P P P PP PPP P Sbjct: 403 PPPPAPPTL--VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVE 460 Query: 674 XPP--------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP P P PP P P P Sbjct: 461 PPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498 Score = 64.9 bits (151), Expect = 2e-10 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP APP PPP PAPP P P P P P PPP P P Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPP 484 Query: 680 PXPPPPGPPXXPPXXPP 730 P P PP PP PP Sbjct: 485 PPPAPPKVELPPPPAPP 501 Score = 59.7 bits (138), Expect = 6e-09 Identities = 46/167 (27%), Positives = 47/167 (28%), Gaps = 7/167 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR- 654 P PP P P PP PP P P P P P P PP+PP Sbjct: 353 PKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAPPTL 411 Query: 655 --PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP 828 P P P P P PP PPPPP Sbjct: 412 VPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPP------------------TVEPPPPPP 453 Query: 829 PXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP----XPPAPXP 957 P P PP PP P P PP P PP P P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Score = 46.4 bits (105), Expect = 6e-05 Identities = 37/133 (27%), Positives = 38/133 (28%), Gaps = 16/133 (12%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXP------PPXPXAPXXXXXPXP-PPAPP---PPXXXPPXPP 650 P P+ PP PP P PP P P P P PPA P PP PP Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPP 403 Query: 651 PPXXPXXXXXXXXXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPP 830 PP P P P PP P PPP Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPP 463 Query: 831 XP------PXPPP 851 P P PPP Sbjct: 464 PPAPAEVEPPPPP 476 Score = 42.7 bits (96), Expect = 7e-04 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P P PP P PP P PP P P PP+PP+ Sbjct: 444 PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPPK 502 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 116 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 173 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 174 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 232 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 233 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 273 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 169 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 226 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 227 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 286 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 325 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 149 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 207 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 208 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 267 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 268 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 303 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 175 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 233 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 234 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 293 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 294 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 334 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 222 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 278 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 279 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 331 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 332 YGGGSGASASASASASAGAGGG 353 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 34 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 93 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 94 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 153 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 154 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 186 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 31 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 84 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 85 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 140 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 141 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 175 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 63 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 119 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 120 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 177 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 178 GFGGGIGGGGGHSGGGGGIGG 198 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 194 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 253 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 254 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 313 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 314 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 352 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 145 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 204 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 205 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 264 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 265 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 303 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 28 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 86 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 87 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 146 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 147 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 185 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 223 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 282 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 283 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 335 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 225 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 284 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 285 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 337 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 30 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 88 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 89 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 117 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 256 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 314 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 315 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 356 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 79.4 bits (187), Expect = 7e-15 Identities = 57/161 (35%), Positives = 58/161 (36%), Gaps = 7/161 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG G G +G G G G G G GG Sbjct: 102 GGGHSGGGGGFGGGPGFG--SGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGI 159 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGX----GXAGGGXGGXXXXXX 616 G G G G GG GG GGPG GGG GG G GGG GG Sbjct: 160 GGGPGFGGGIGGGGGHSGGG-GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGG 218 Query: 615 GXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G G G GG G G G G G GGG P GG GG Sbjct: 219 GFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGG 259 Score = 74.5 bits (175), Expect = 2e-13 Identities = 56/159 (35%), Positives = 56/159 (35%), Gaps = 5/159 (3%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GGGG G G G GG G G GG Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG-GGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGG 212 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX---GGXXXXXXGX 610 G G G G G G GG G GGG GG G G GG GG G Sbjct: 213 GGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGH 272 Query: 609 GXGXG--GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG G G G GG GG Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG 311 Score = 73.7 bits (173), Expect = 3e-13 Identities = 51/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG--GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 G G G GG GG GG +G G G G GG G G GG Sbjct: 135 GSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGG-GGHSGGGGGIGGGPGFGGGIG 193 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 + G G GG GG G GGGG G G G G GG G G Sbjct: 194 GSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIG 253 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GGG GG GG Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 70.5 bits (165), Expect = 3e-12 Identities = 56/161 (34%), Positives = 57/161 (35%), Gaps = 12/161 (7%) Frame = -3 Query: 960 GGXG-RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG GG GGGG G G G G GG G G Sbjct: 161 GGPGFGGGIGGGGGHSGGGGGIGGGPGFG-GGIGGSGSSASSSVGVIGGGHGGGGHGGGG 219 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGG--PG-GGGXGGXXXGXGXA--------GGGXG 637 G G G G G G GG GG PG GGG GG G G + GGG Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFK 279 Query: 636 GXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG G G GG G GG GG Sbjct: 280 GGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGG 320 Score = 70.5 bits (165), Expect = 3e-12 Identities = 49/142 (34%), Positives = 49/142 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG G G GG Sbjct: 208 GGHGGGGHGGGGFGPGGGGGGGFGPG---GGGFGPGIGGGGGGFGPGIGGGSGGGHFGGG 264 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GGGG G GG GG G G Sbjct: 265 LSHKHKGHGG--GGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGG-----GSYGGG 317 Query: 600 XGGXXGXGXXXXGXGGAGXGGG 535 GG G AG GGG Sbjct: 318 YGGGSGASASASASASAGAGGG 339 Score = 68.1 bits (159), Expect = 2e-11 Identities = 50/156 (32%), Positives = 53/156 (33%), Gaps = 2/156 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG + G G GG G G Sbjct: 20 GGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLG 79 Query: 780 XXXGAXGXGXXXGXGXXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GG GG G G G +GGG G G Sbjct: 80 LGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGY 139 Query: 606 XGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG+G GGG P GG GG Sbjct: 140 SGGGGGIGGGGGHSG-GGSGIGGG--PGFGGGIGGG 172 Score = 66.1 bits (154), Expect = 7e-11 Identities = 51/157 (32%), Positives = 53/157 (33%), Gaps = 3/157 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G + GA GG G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSG------ 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX---GGXXXGXGXAGGGXGGXXXXXXGX 610 G G G G G G GG GGG GG G G GGG G G Sbjct: 71 ----GFGSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGG 126 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG GG+ GG Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH--SGGGSGIGG 161 Score = 65.3 bits (152), Expect = 1e-10 Identities = 49/141 (34%), Positives = 50/141 (35%), Gaps = 3/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GGG G G G+G G G G GG G G G G Sbjct: 49 GGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPFAGGHA---GGGVISGGGH 105 Query: 732 XGGXXGGXXGGPG--GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGPG GG G G G G G GG G G G G G G Sbjct: 106 SGGG-GGFGGGPGFGSGGHSGGGIGDG-PGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGP 163 Query: 558 G-GAGXGGGXXPXXGGAXXGG 499 G G G GGG GG GG Sbjct: 164 GFGGGIGGGGGHSGGGGGIGG 184 Score = 61.7 bits (143), Expect = 1e-09 Identities = 48/160 (30%), Positives = 49/160 (30%), Gaps = 6/160 (3%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G G G GG G + G G G G G GG Sbjct: 180 GGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGP 239 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXX-----GGPGGGGXGGXXXGXGXAGGGXGGXXXXX 619 G G G G G GG GG G GGGG G G G GGG GG Sbjct: 240 GIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIG 299 Query: 618 XGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG A GG Sbjct: 300 PAVSLG-GGPGGGGSYGGGYGGGSGASASASASASAGAGG 338 Score = 56.8 bits (131), Expect = 4e-08 Identities = 47/159 (29%), Positives = 48/159 (30%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGGXXXXXXXXX 786 G G G+GG GG G GGG G GG GG G GGGGG Sbjct: 131 GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG 190 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRG---GXGGXXXXXXX 615 G G G G G G G G G GG Sbjct: 191 GIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGP 250 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G G GG G G GGGG G GG Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGG 289 Score = 52.8 bits (121), Expect = 7e-07 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 5/159 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG---GGXXGXGGGGGGXXXXXXXX 789 A G G G GG G G GG GG GG G GG G G Sbjct: 14 ASAGGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSG-GLGSGGF 72 Query: 788 XXXXXXXXXXXGXXGGP--GXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G GGP G G G G GG G Sbjct: 73 GSGGDLGLGGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHSGGGIGDGP 132 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G G GG GG G G G GG Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG 171 Score = 49.6 bits (113), Expect = 6e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 1/114 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 G G GG GGG G G G G G Sbjct: 209 GHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHK 268 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G GGGG GGG G G A GGG GG GG G G Sbjct: 269 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGG-GGSYGGGYGGG 321 Score = 48.8 bits (111), Expect = 1e-05 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 2/113 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG G GG G G GG G G Sbjct: 211 GGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHK 270 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG GG GG GGGG GGG G G GG G GGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 43.2 bits (97), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 1/91 (1%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG G G G G G GGG G G G G G Sbjct: 16 AGGYGGGGGGGG-GGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGS 74 Query: 588 XGX-GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG GG GG GG Sbjct: 75 GGDLGLGGGGVGGGPFAGGH--AGGGVISGG 103 Score = 36.3 bits (80), Expect = 0.063 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG G G G GG G + G Sbjct: 242 GGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKG-GYGGGGGGGGGGGGGYGIGP 300 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG G GG GGG GGG G A G GG G Sbjct: 301 AVSLGGGPGGGGSY--GGGYGGGSGASASASASASAGAGGGYHG 342 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 70.5 bits (165), Expect = 3e-12 Identities = 54/155 (34%), Positives = 54/155 (34%), Gaps = 1/155 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G GG GGGG G G G G GG G G GG Sbjct: 61 GGGGGGYSGGYSGGHGGGGGYGGG-GYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYG 119 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G G GG GG GG GGG G G G GGG G G Sbjct: 120 GGYGG-GHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGGYGGG-GNVKIIKVISDAG 177 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG-AXXGG 499 G G G GG GG GG A GG Sbjct: 178 SSGGYGGGYGGGHGGGYSSGGASSYSAGGWAPQGG 212 Score = 54.0 bits (124), Expect = 3e-07 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 1/89 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G GG GG GG GG G G GGG GG G G G Sbjct: 45 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKI 104 Query: 585 GXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 105 IKVITDSGAGGGGYGGGYGGGHGGGYGGG 133 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG G + GG G G G GG GG GGG G G Sbjct: 42 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYG 92 Score = 45.2 bits (102), Expect = 1e-04 Identities = 43/155 (27%), Positives = 45/155 (29%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+ +G GG G G G GG GGGG G G GGG Sbjct: 51 GSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITD 110 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G GG GG G G Sbjct: 111 SGAGGGGYGGGYGG-GHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGG------GGYGG 163 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG G G GGG G G GG Sbjct: 164 GGNVKIIKVISDAGSSGGYGGGYGGGHGGGYSSGG 198 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GGG G G G GG G G GG G GG GG GG Sbjct: 42 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 95 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 68.5 bits (160), Expect = 1e-11 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P P PP P P P PP PPP P PP PPPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGG 544 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 545 GGIPPPPPPMSASP 558 Score = 62.1 bits (144), Expect = 1e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP PP P P P PP P P P PP PPP P P Sbjct: 480 PHAVAPPPP---PPP---PPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 533 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 534 PPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 58.0 bits (134), Expect = 2e-08 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXX-PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP PPP P PP P PP P P P PP PPPA Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 546 Query: 677 PPXPPPP--GPPXXPPXXPPXXPXP 745 P PPPP P P P P Sbjct: 547 IPPPPPPMSASPSKTTISPAPLPDP 571 Score = 55.6 bits (128), Expect = 1e-07 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PPP P P PPP PPPP PPPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PPPP P P P P PP PP P P PP PP P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPP 526 Score = 49.6 bits (113), Expect = 6e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P P PPPP PP PP P P P P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPP 527 Score = 49.2 bits (112), Expect = 8e-06 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PPP PP P P AP P PPP PPPP PPPP P Sbjct: 480 PHAVAPPPPPPPPPLPAFVAP---PPPPPPPPPPPPLANYGAPPPPPPP 525 Score = 48.4 bits (110), Expect = 1e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 8/56 (14%) Frame = +1 Query: 814 PPPPPPXPXXP----PPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P P PPP PP PPP P PP P PP P P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPPP P PPPP PP PPP P PP P PA Sbjct: 488 PPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA 539 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR-PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P PPPP P PP P P PP P P PP PP Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA 539 Query: 655 P 657 P Sbjct: 540 P 540 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPP------XXPPXXPPXXPXPXXXPXP 763 P PP PPP P PP PPPP PP PP PP P P P Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPP 535 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP----GPPXXPPXXPPXXPXPXXXPX 760 PP P P P PP PPP PP PPPP G P PP PP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPP--------PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 537 Query: 761 P 763 P Sbjct: 538 P 538 Score = 43.2 bits (97), Expect = 5e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P AP P P PPPP PP P PP Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPP 525 Score = 40.3 bits (90), Expect = 0.004 Identities = 29/99 (29%), Positives = 29/99 (29%) Frame = +2 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 P P PPPP PP PP P P P P A Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLA--------------------NYGAP 519 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP P Sbjct: 520 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 13/69 (18%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPX------PXPXPXPPX----PPXPXP---XXXXXXXP 639 PP P P PPPP P PP P P P PP PP P P P Sbjct: 490 PPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPP 549 Query: 640 PSPPRPXXP 666 P PP P Sbjct: 550 PPPPMSASP 558 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 502 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 521 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 572 Score = 33.5 bits (73), Expect = 0.44 Identities = 31/109 (28%), Positives = 32/109 (29%) Frame = +1 Query: 550 RPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXXXXPX 729 +P P P P PP P P PP PP P P P Sbjct: 479 KPHAVAPPPPPPPPPLPAFVAP-------PPPPPPPPPP-----------PPLANYGAPP 520 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP PPPPPP P PP PPP Sbjct: 521 PPPPPP----------------PGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 519 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 559 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 68.5 bits (160), Expect = 1e-11 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P P PP P P P PP PPP P PP PPPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGG 639 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 640 GGIPPPPPPMSASP 653 Score = 62.1 bits (144), Expect = 1e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP PP P P P PP P P P PP PPP P P Sbjct: 575 PHAVAPPPP---PPP---PPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAP 628 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 629 PPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 58.0 bits (134), Expect = 2e-08 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXX-PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP PPP P PP P PP P P P PP PPPA Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 641 Query: 677 PPXPPPP--GPPXXPPXXPPXXPXP 745 P PPPP P P P P Sbjct: 642 IPPPPPPMSASPSKTTISPAPLPDP 666 Score = 55.6 bits (128), Expect = 1e-07 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PPP P P PPP PPPP PPPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PPPP P P P P PP PP P P PP PP P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPP 621 Score = 49.6 bits (113), Expect = 6e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P P PPPP PP PP P P P P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 49.2 bits (112), Expect = 8e-06 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PPP PP P P AP P PPP P PP PPPP Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 620 Score = 49.2 bits (112), Expect = 8e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PPP PP PPP P A P PPP PPPP PPPP P Sbjct: 580 PPPPPP-PPPLP-AFVAPPPPPPPPPPPPPMANYGAPPPPPPP 620 Score = 48.4 bits (110), Expect = 1e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 8/56 (14%) Frame = +1 Query: 814 PPPPPPXPXXP----PPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P P PPP PP PPP P PP P PP P P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPPP P PPPP PP PPP P PP P PA Sbjct: 583 PPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA 634 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR-PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P PPPP P PP P P PP P P PP PP Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA 634 Query: 655 P 657 P Sbjct: 635 P 635 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPP------XXPPXXPPXXPXPXXXPXP 763 P PP PPP P PP PPPP PP PP PP P P P Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPP 630 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPXPA-----PXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP PA P P P PPPP P PP P PP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP----GPPXXPPXXPPXXPXPXXXPX 760 PP P P P PP PPP PP PPPP G P PP PP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPP--------PPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 632 Query: 761 P 763 P Sbjct: 633 P 633 Score = 43.2 bits (97), Expect = 5e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P AP P P PPPP PP P PP Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 620 Score = 40.3 bits (90), Expect = 0.004 Identities = 29/99 (29%), Positives = 29/99 (29%) Frame = +2 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 P P PPPP PP PP P P P P A Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMA--------------------NYGAP 614 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP P Sbjct: 615 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 13/69 (18%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPX------PXPXPXPPX----PPXPXP---XXXXXXXP 639 PP P P PPPP P PP P P P PP PP P P P Sbjct: 585 PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPP 644 Query: 640 PSPPRPXXP 666 P PP P Sbjct: 645 PPPPMSASP 653 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 597 PPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 616 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 667 Score = 33.5 bits (73), Expect = 0.44 Identities = 31/109 (28%), Positives = 32/109 (29%) Frame = +1 Query: 550 RPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXXXXPX 729 +P P P P PP P P PP PP P P P Sbjct: 574 KPHAVAPPPPPPPPPLPAFVAP-------PPPPPPPPPP-----------PPMANYGAPP 615 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP PPPPPP P PP PPP Sbjct: 616 PPPPPP----------------PGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 614 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 654 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 68.5 bits (160), Expect = 1e-11 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P P PP P P P PP PPP P PP PPPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPP-PPPPAPIEGG 772 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 773 GGIPPPPPPMSASP 786 Score = 62.1 bits (144), Expect = 1e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP PP P P P PP P P P PP PPP P P Sbjct: 708 PHAVAPPPP---PPP---PPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAP 761 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 762 PPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 58.0 bits (134), Expect = 2e-08 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXX-PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP PPP P PP P PP P P P PP PPPA Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 774 Query: 677 PPXPPPP--GPPXXPPXXPPXXPXP 745 P PPPP P P P P Sbjct: 775 IPPPPPPMSASPSKTTISPAPLPDP 799 Score = 55.6 bits (128), Expect = 1e-07 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PPP P P PPP PPPP PPPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 50.4 bits (115), Expect = 4e-06 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PPPP P P P P PP PP P P PP PP P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPP 754 Score = 49.6 bits (113), Expect = 6e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P P PPPP PP PP P P P P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 49.2 bits (112), Expect = 8e-06 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PPP PP P P AP P PPP P PP PPPP Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 753 Score = 49.2 bits (112), Expect = 8e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PPP PP PPP P A P PPP PPPP PPPP P Sbjct: 713 PPPPPP-PPPLP-AFVAPPPPPPPPPPPPPMANYGAPPPPPPP 753 Score = 48.4 bits (110), Expect = 1e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 8/56 (14%) Frame = +1 Query: 814 PPPPPPXPXXP----PPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P P PPP PP PPP P PP P PP P P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPPP P PPPP PP PPP P PP P PA Sbjct: 716 PPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA 767 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR-PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P PPPP P PP P P PP P P PP PP Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPA 767 Query: 655 P 657 P Sbjct: 768 P 768 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPP------XXPPXXPPXXPXPXXXPXP 763 P PP PPP P PP PPPP PP PP PP P P P Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPP 763 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPXPA-----PXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP PA P P P PPPP P PP P PP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP----GPPXXPPXXPPXXPXPXXXPX 760 PP P P P PP PPP PP PPPP G P PP PP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPP--------PPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 765 Query: 761 P 763 P Sbjct: 766 P 766 Score = 43.2 bits (97), Expect = 5e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P AP P P PPPP PP P PP Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 753 Score = 40.3 bits (90), Expect = 0.004 Identities = 29/99 (29%), Positives = 29/99 (29%) Frame = +2 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 P P PPPP PP PP P P P P A Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMA--------------------NYGAP 747 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP P Sbjct: 748 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 13/69 (18%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPX------PXPXPXPPX----PPXPXP---XXXXXXXP 639 PP P P PPPP P PP P P P PP PP P P P Sbjct: 718 PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPP 777 Query: 640 PSPPRPXXP 666 P PP P Sbjct: 778 PPPPMSASP 786 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 730 PPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 749 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 800 Score = 33.5 bits (73), Expect = 0.44 Identities = 31/109 (28%), Positives = 32/109 (29%) Frame = +1 Query: 550 RPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXXXXPX 729 +P P P P PP P P PP PP P P P Sbjct: 707 KPHAVAPPPPPPPPPLPAFVAP-------PPPPPPPPPP-----------PPMANYGAPP 748 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP PPPPPP P PP PPP Sbjct: 749 PPPPPP----------------PGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 747 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 787 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 68.1 bits (159), Expect = 2e-11 Identities = 53/155 (34%), Positives = 53/155 (34%), Gaps = 1/155 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G GG GGGG G G G G GG G G GG Sbjct: 36 GGGGGGYSGGYSGGHGGGGGYGGG-GYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYG 94 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G G GG GG GG GGG G G G G G G G Sbjct: 95 GGYGG-GHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGGYGSG-GNVKIIKVISDAG 152 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG-AXXGG 499 G G G GG GG GG A GG Sbjct: 153 SSGGYGGGYGGGHGGGYSSGGASSYSAGGWAPQGG 187 Score = 54.0 bits (124), Expect = 3e-07 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 1/89 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G GG GG GG GG G G GGG GG G G G Sbjct: 20 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKI 79 Query: 585 GXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 80 IKVITDSGAGGGGYGGGYGGGHGGGYGGG 108 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG G + GG G G G GG GG GGG G G Sbjct: 17 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYG 67 Score = 45.2 bits (102), Expect = 1e-04 Identities = 43/155 (27%), Positives = 45/155 (29%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+ +G GG G G G GG GGGG G G GGG Sbjct: 26 GSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITD 85 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G G GG GG G G Sbjct: 86 SGAGGGGYGGGYGG-GHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGG------GGYGS 138 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GG G G GGG G G GG Sbjct: 139 GGNVKIIKVISDAGSSGGYGGGYGGGHGGGYSSGG 173 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GGG G G G GG G G GG G GG GG GG Sbjct: 17 GFLGGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGG 70 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 67.7 bits (158), Expect = 2e-11 Identities = 47/158 (29%), Positives = 47/158 (29%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGA----GXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG G GG GG GGGG G G G G GG G G G Sbjct: 234 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTN 293 Query: 792 XXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G GG GG GG GGGG G GGG Sbjct: 294 FAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNS 353 Query: 612 XGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G G GG G GG Sbjct: 354 QGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGG 391 Score = 61.7 bits (143), Expect = 1e-09 Identities = 29/61 (47%), Positives = 29/61 (47%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G G G G G GG G GG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 273 Query: 537 G 535 G Sbjct: 274 G 274 Score = 57.6 bits (133), Expect = 2e-08 Identities = 48/163 (29%), Positives = 48/163 (29%), Gaps = 9/163 (5%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXG----AGXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG GRGG GG GGGG G G G G GG G G GG Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 277 Query: 792 XXXXXXXGA-----XGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXX 628 G G GGGG G G G GGG G Sbjct: 278 QPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGG----GYGGGGGGGGYDR 333 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G GG G GGG GG Sbjct: 334 GNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 376 Score = 56.4 bits (130), Expect = 5e-08 Identities = 29/71 (40%), Positives = 29/71 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG GG GG G G G GGG GG G G GG G G GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Query: 549 GXGGGXXPXXG 517 G GG P G Sbjct: 272 GGGGNVQPRDG 282 Score = 55.2 bits (127), Expect = 1e-07 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G GG GG GGGG GGG G G GGG GG GGG G G G Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGG 272 Score = 54.8 bits (126), Expect = 2e-07 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGG-XXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G GG GG GG GGGG GG G G G G GG G G G GG Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Query: 585 G 583 G Sbjct: 275 G 275 Score = 52.0 bits (119), Expect = 1e-06 Identities = 49/161 (30%), Positives = 49/161 (30%), Gaps = 6/161 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 212 GGGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGGG--------NG 255 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGG----XGGXXXXXXX 615 G GG G G G G Sbjct: 256 GGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSG 315 Query: 614 GXGXGGXGGXGXGXG--XGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG G G G G G GGGG G GG Sbjct: 316 GGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGG 356 Score = 49.6 bits (113), Expect = 6e-06 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXX--GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG GGG G G GGG G GGG G G G Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX------GXGXXXXGXGG 553 G GG G G G GGG GG G G GG G G G GG Sbjct: 42 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Query: 552 AGXGGG 535 G GGG Sbjct: 102 GGGGGG 107 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG G GG + G G G GG GG GGG G G Sbjct: 63 GGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSG 110 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G G G G GGGG G G G G G GG G Sbjct: 45 GGGYDSGSGHRGS---GGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Query: 582 XGXXXXGXGG 553 G G GG Sbjct: 102 GGGGGGGSGG 111 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGG 816 G+G G+GG G GG G GG G GG GGG G GGGGG Sbjct: 51 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGG 108 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G+G G GG G GG + GG G GGGG G GG GG Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 32.7 bits (71), Expect = 0.77 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG----------GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G G GG G GGG G GG G G GG GG GGG G Sbjct: 53 GHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GGGG GG GGG G Sbjct: 323 GGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGG 382 Query: 583 XGAXGXGGGXGGXGGG 536 G GG GG Sbjct: 383 GGGNRRDGGPMRNDGG 398 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G GG G GG GGG GG GGGG GG Sbjct: 355 GGGGGGGGGGGYS--------RFNDNNGGGRGGRGGGGGNRRDGG 391 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 67.7 bits (158), Expect = 2e-11 Identities = 47/158 (29%), Positives = 47/158 (29%), Gaps = 4/158 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGA----GXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG G GG GG GGGG G G G G GG G G G Sbjct: 234 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTN 293 Query: 792 XXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G GG GG GG GGGG G GGG Sbjct: 294 FAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNS 353 Query: 612 XGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G G GG G GG Sbjct: 354 QGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGG 391 Score = 61.7 bits (143), Expect = 1e-09 Identities = 29/61 (47%), Positives = 29/61 (47%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G G G G G GG G GG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 273 Query: 537 G 535 G Sbjct: 274 G 274 Score = 57.6 bits (133), Expect = 2e-08 Identities = 48/163 (29%), Positives = 48/163 (29%), Gaps = 9/163 (5%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXG----AGXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG GRGG GG GGGG G G G G GG G G GG Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 277 Query: 792 XXXXXXXGA-----XGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXX 628 G G GGGG G G G GGG G Sbjct: 278 QPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGG----GYGGGGGGGGYDR 333 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G GG G GGG GG Sbjct: 334 GNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 376 Score = 56.4 bits (130), Expect = 5e-08 Identities = 29/71 (40%), Positives = 29/71 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG GG GG G G G GGG GG G G GG G G GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Query: 549 GXGGGXXPXXG 517 G GG P G Sbjct: 272 GGGGNVQPRDG 282 Score = 55.2 bits (127), Expect = 1e-07 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G GG GG GGGG GGG G G GGG GG GGG G G G Sbjct: 218 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGG 272 Score = 54.8 bits (126), Expect = 2e-07 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGG-XXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G GG GG GG GGGG GG G G G G GG G G G GG Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 Query: 585 G 583 G Sbjct: 275 G 275 Score = 52.0 bits (119), Expect = 1e-06 Identities = 49/161 (30%), Positives = 49/161 (30%), Gaps = 6/161 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 212 GGGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGGG--------NG 255 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGG----XGGXXXXXXX 615 G GG G G G G Sbjct: 256 GGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSG 315 Query: 614 GXGXGGXGGXGXGXG--XGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG G G G G G GGGG G GG Sbjct: 316 GGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGG 356 Score = 49.6 bits (113), Expect = 6e-06 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXX--GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG GGG G G GGG G GGG G G G Sbjct: 215 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX------GXGXXXXGXGG 553 G GG G G G GGG GG G G GG G G G GG Sbjct: 42 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Query: 552 AGXGGG 535 G GGG Sbjct: 102 GGGGGG 107 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG G GG + G G G GG GG GGG G G Sbjct: 63 GGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSG 110 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G G G G GGGG G G G G G GG G Sbjct: 45 GGGYDSGSGHRGS---GGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Query: 582 XGXXXXGXGG 553 G G GG Sbjct: 102 GGGGGGGSGG 111 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGG 816 G+G G+GG G GG G GG G GG GGG G GGGGG Sbjct: 51 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGG 108 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G+G G GG G GG + GG G GGGG G GG GG Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 32.7 bits (71), Expect = 0.77 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG----------GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G G GG G GGG G GG G G GG GG GGG G Sbjct: 53 GHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GGGG GG GGG G Sbjct: 323 GGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGG 382 Query: 583 XGAXGXGGGXGGXGGG 536 G GG GG Sbjct: 383 GGGNRRDGGPMRNDGG 398 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G GG G GG GGG GG GGGG GG Sbjct: 355 GGGGGGGGGGGYS--------RFNDNNGGGRGGRGGGGGNRRDGG 391 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/88 (40%), Positives = 37/88 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G +GGG G G G G GG G Sbjct: 39 GLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFG 98 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GG GG GG Sbjct: 99 GGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 65.3 bits (152), Expect = 1e-10 Identities = 35/82 (42%), Positives = 35/82 (42%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG GG GGG GG G G GG GG G G GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGF--GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 64.1 bits (149), Expect = 3e-10 Identities = 37/92 (40%), Positives = 38/92 (41%), Gaps = 4/92 (4%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG----XGGXXXXXXGXGXGXG 595 G G G G GG GG GG GGG GG G G GG GG G G G G Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGG 90 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G G G GG GG Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGG 122 Score = 63.3 bits (147), Expect = 5e-10 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 2/90 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G G G GG G G G GG G Sbjct: 35 GSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFG 94 Query: 582 XGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G GG+ G GGG G GG Sbjct: 95 GGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 61.3 bits (142), Expect = 2e-09 Identities = 35/88 (39%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GG GG G G GG GG G G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGI--GGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G GGG GG GG Sbjct: 85 VGGGGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 60.1 bits (139), Expect = 4e-09 Identities = 41/110 (37%), Positives = 43/110 (39%), Gaps = 1/110 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G GG GGG G G G+G GG G GG Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGG--------------------- 80 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGG-GXGGXXXGXGXAGGGXGG 634 + G G G G GG GG GG GGG G GG G G GGG GG Sbjct: 81 ---FSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 52.4 bits (120), Expect = 9e-07 Identities = 34/103 (33%), Positives = 34/103 (33%) Frame = -2 Query: 847 GGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXX 668 GG GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Query: 667 XGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGGG GG GG G G G G G GGG GG GG Sbjct: 87 GG--GGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 52.0 bits (119), Expect = 1e-06 Identities = 29/68 (42%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG-GAGXGGGXXPX 523 PGGGG G G G GGG GG G G G G G G G G +G GGG Sbjct: 26 PGGGGGSGGGSG-GGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 522 XGGAXXGG 499 GG GG Sbjct: 85 VGGGGGGG 92 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GGG G GGG GG Sbjct: 57 GGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGG 107 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGG Sbjct: 65 GGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGG 113 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G + G G GG G GGG GG G G G GGGGGG Sbjct: 77 GGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/55 (45%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGX-GGGXGGXG--GGXXXXXGXG 512 G GG GG G GGG GGG G G+ G GGG GG G GG G G Sbjct: 71 GGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGG 125 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG---GGGGGXXXXXXX 792 G G GG G G G GGG GG GGG G G GGGGG Sbjct: 28 GGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGG 87 Query: 791 XXXXXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFG 110 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 P G G G +GGG GG G G G G G G G G GGG Sbjct: 17 PEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSG 76 Query: 519 GG 514 GG Sbjct: 77 GG 78 Score = 38.7 bits (86), Expect = 0.012 Identities = 33/109 (30%), Positives = 34/109 (31%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G+GG GG G GG GG GGG G GGG GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSS------GGFGGGIGGGFGGGFGGGSGG----GGFSSG 76 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG 636 G GG G G G G G GG GG Sbjct: 77 GGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGG 125 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/88 (40%), Positives = 37/88 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G +GGG G G G G GG G Sbjct: 39 GLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFG 98 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GG GG GG Sbjct: 99 GGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 65.3 bits (152), Expect = 1e-10 Identities = 35/82 (42%), Positives = 35/82 (42%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG GG GGG GG G G GG GG G G GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGF--GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 64.1 bits (149), Expect = 3e-10 Identities = 37/92 (40%), Positives = 38/92 (41%), Gaps = 4/92 (4%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG----XGGXXXXXXGXGXGXG 595 G G G G GG GG GG GGG GG G G GG GG G G G G Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G G G GG GG Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGG 122 Score = 63.3 bits (147), Expect = 5e-10 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 2/90 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G G G GG G G G GG G Sbjct: 35 GSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG 94 Query: 582 XGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G GG+ G GGG G GG Sbjct: 95 GGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 61.3 bits (142), Expect = 2e-09 Identities = 35/88 (39%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GG GG G G GG GG G G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGI--GGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G GGG GG GG Sbjct: 85 GGGGGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/67 (41%), Positives = 29/67 (43%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 PGGGG G G G GGG GG G G G G G G G G + GGG Sbjct: 26 PGGGGGSGGGSG-GGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 519 GGAXXGG 499 GG GG Sbjct: 85 GGGGGGG 91 Score = 52.4 bits (120), Expect = 9e-07 Identities = 34/103 (33%), Positives = 34/103 (33%) Frame = -2 Query: 847 GGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXX 668 GG GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 667 XGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGGG GG GG G G G G G GGG GG GG Sbjct: 87 GG--GGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GGG G GGG GG Sbjct: 57 GGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGG 107 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGG Sbjct: 65 GGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGG 113 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G + G G GG G GGG GG G G G GGGGGG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G +GG G GG G GG GG GG G GGGGGG Sbjct: 78 GGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G GGG GGGG GGGGGG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG---GGGGGXXXXXXX 792 G G GG G G G GGG GG GGG G G GGGGG Sbjct: 28 GGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGG 87 Query: 791 XXXXXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFG 110 Score = 40.7 bits (91), Expect = 0.003 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG--XGXGGXXGXGXXXXGXGGAGXGGGXXP 526 P G G G +GGG GG G G G GG G G GG+G GG Sbjct: 17 PEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSG 76 Query: 525 XXGGAXXGG 499 GG GG Sbjct: 77 GGGGFSSGG 85 Score = 40.3 bits (90), Expect = 0.004 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+ G GG GG G GGG G GGG G GG GGG Sbjct: 47 GSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSG 106 Query: 782 XXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 107 GGFGGGGSIGGFGGGGGGGG 126 Score = 38.7 bits (86), Expect = 0.012 Identities = 33/109 (30%), Positives = 34/109 (31%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G+GG GG G GG GG GGG G GGG GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSS------GGFGGGIGGGFGGGFGGGSGG----GGFSSG 76 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG 636 G GG G G G G G GG GG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGG 125 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/88 (40%), Positives = 37/88 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G +GGG G G G G GG G Sbjct: 39 GLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFG 98 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GG GG GG Sbjct: 99 GGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 65.3 bits (152), Expect = 1e-10 Identities = 35/82 (42%), Positives = 35/82 (42%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG GG GGG GG G G GG GG G G GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGF--GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 64.1 bits (149), Expect = 3e-10 Identities = 37/92 (40%), Positives = 38/92 (41%), Gaps = 4/92 (4%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG----XGGXXXXXXGXGXGXG 595 G G G G GG GG GG GGG GG G G GG GG G G G G Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G G G GG GG Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGG 122 Score = 63.3 bits (147), Expect = 5e-10 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 2/90 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G G G GG G G G GG G Sbjct: 35 GSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG 94 Query: 582 XGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G GG+ G GGG G GG Sbjct: 95 GGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 61.3 bits (142), Expect = 2e-09 Identities = 35/88 (39%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GG GG G G GG GG G G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGI--GGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G GGG GG GG Sbjct: 85 GGGGGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/67 (41%), Positives = 29/67 (43%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 PGGGG G G G GGG GG G G G G G G G G + GGG Sbjct: 26 PGGGGGSGGGSG-GGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 519 GGAXXGG 499 GG GG Sbjct: 85 GGGGGGG 91 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GGG G GGG GG Sbjct: 57 GGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGG 107 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGG Sbjct: 65 GGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGG 113 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G + G G GG G GGG GG G G G GGGGGG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G GGG GGGG GGGGGG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG---GGGGGXXXXXXX 792 G G GG G G G GGG GG GGG G G GGGGG Sbjct: 28 GGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGG 87 Query: 791 XXXXXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFG 110 Score = 40.7 bits (91), Expect = 0.003 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG--XGXGGXXGXGXXXXGXGGAGXGGGXXP 526 P G G G +GGG GG G G G GG G G GG+G GG Sbjct: 17 PEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSG 76 Query: 525 XXGGAXXGG 499 GG GG Sbjct: 77 GGGGFSSGG 85 Score = 40.3 bits (90), Expect = 0.004 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+ G GG GG G GGG G GGG G GG GGG Sbjct: 47 GSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSG 106 Query: 782 XXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 107 GGFGGGGSIGGFGGGGGGGG 126 Score = 38.7 bits (86), Expect = 0.012 Identities = 33/109 (30%), Positives = 34/109 (31%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G+GG GG G GG GG GGG G GGG GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSS------GGFGGGIGGGFGGGFGGGSGG----GGFSSG 76 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG 636 G GG G G G G G GG GG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGG 125 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 2/94 (2%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GG GG GGG G G GG G Sbjct: 34 GGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGF 93 Query: 670 XXGXXGG--GGXGGXXXGGGGAGGGXGXXXXXGA 575 G GG GG GG GGG GG G GA Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGA 127 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 67.7 bits (158), Expect = 2e-11 Identities = 36/88 (40%), Positives = 37/88 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G +GGG G G G G GG G Sbjct: 39 GLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFG 98 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GG GG GG Sbjct: 99 GGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 65.3 bits (152), Expect = 1e-10 Identities = 35/82 (42%), Positives = 35/82 (42%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG GG GGG GG G G GG GG G G GG G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGF--GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 87 GGGGGGFGGGFGGGSGGGSGGG 108 Score = 64.1 bits (149), Expect = 3e-10 Identities = 37/92 (40%), Positives = 38/92 (41%), Gaps = 4/92 (4%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG----XGGXXXXXXGXGXGXG 595 G G G G GG GG GG GGG GG G G GG GG G G G G Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G G G GG GG Sbjct: 91 GGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGG 122 Score = 63.3 bits (147), Expect = 5e-10 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 2/90 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGG GG G G G GG G G G GG G Sbjct: 35 GSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFG 94 Query: 582 XGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 G GG+ G GGG G GG Sbjct: 95 GGFGGGSGGGSGGGFGGGGSIGGFGGGGGG 124 Score = 61.3 bits (142), Expect = 2e-09 Identities = 35/88 (39%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GG GG G G GG GG G G G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGI--GGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G GGG GG GG Sbjct: 85 GGGGGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/67 (41%), Positives = 29/67 (43%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 PGGGG G G G GGG GG G G G G G G G G + GGG Sbjct: 26 PGGGGGSGGGSG-GGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSG 84 Query: 519 GGAXXGG 499 GG GG Sbjct: 85 GGGGGGG 91 Score = 52.4 bits (120), Expect = 9e-07 Identities = 34/103 (33%), Positives = 34/103 (33%) Frame = -2 Query: 847 GGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXX 668 GG GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 667 XGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGGG GG GG G G G G G GGG GG GG Sbjct: 87 GG--GGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GGG G GGG GG Sbjct: 57 GGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGG 107 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGG Sbjct: 65 GGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGG 113 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G + G G GG G GGG GG G G G GGGGGG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G +GG G GG G GG GG GG G GGGGGG Sbjct: 78 GGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGG 127 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G GGG GGGG GGGGGG Sbjct: 41 GGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGG 90 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG---GGGGGXXXXXXX 792 G G GG G G G GGG GG GGG G G GGGGG Sbjct: 28 GGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGG 87 Query: 791 XXXXXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFG 110 Score = 40.7 bits (91), Expect = 0.003 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG--XGXGGXXGXGXXXXGXGGAGXGGGXXP 526 P G G G +GGG GG G G G GG G G GG+G GG Sbjct: 17 PEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSG 76 Query: 525 XXGGAXXGG 499 GG GG Sbjct: 77 GGGGFSSGG 85 Score = 40.3 bits (90), Expect = 0.004 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+ G GG GG G GGG G GGG G GG GGG Sbjct: 47 GSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSG 106 Query: 782 XXXXXXXXXGXXGGPGXGXG 723 G GG G G G Sbjct: 107 GGFGGGGSIGGFGGGGGGGG 126 Score = 38.7 bits (86), Expect = 0.012 Identities = 33/109 (30%), Positives = 34/109 (31%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G+GG GG G GG GG GGG G GGG GG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSS------GGFGGGIGGGFGGGFGGGSGG----GGFSSG 76 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG 636 G GG G G G G G GG GG Sbjct: 77 GGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGG 125 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 65.7 bits (153), Expect = 9e-11 Identities = 48/152 (31%), Positives = 48/152 (31%), Gaps = 10/152 (6%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGA----GXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG G GG GG GGGG G G G G GG G G G Sbjct: 196 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNVQPRDGEWKCNSCNNTN 255 Query: 792 XXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G GG GG GG GGGG G GGG Sbjct: 256 FAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNS 315 Query: 612 XGXGXGGXXGXG------XXXXGXGGAGXGGG 535 G G GG G G G GG G GGG Sbjct: 316 QGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 347 Score = 61.7 bits (143), Expect = 1e-09 Identities = 29/61 (47%), Positives = 29/61 (47%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G G G G G GG G GG Sbjct: 176 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGG 235 Query: 537 G 535 G Sbjct: 236 G 236 Score = 57.6 bits (133), Expect = 2e-08 Identities = 48/163 (29%), Positives = 48/163 (29%), Gaps = 9/163 (5%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXG----AGXGGXXGXGXGGXXXXXXXXXXXXXXXXX 793 GG GRGG GG GGGG G G G G GG G G GG Sbjct: 180 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 239 Query: 792 XXXXXXXGA-----XGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXX 628 G G GGGG G G G GGG G Sbjct: 240 QPRDGEWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGG----GYGGGGGGGGYDR 295 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G GG G GGG GG Sbjct: 296 GNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 338 Score = 56.4 bits (130), Expect = 5e-08 Identities = 29/71 (40%), Positives = 29/71 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG GG GG G G G GGG GG G G GG G G GG Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 233 Query: 549 GXGGGXXPXXG 517 G GG P G Sbjct: 234 GGGGNVQPRDG 244 Score = 55.2 bits (127), Expect = 1e-07 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G GG GG GGGG GGG G G GGG GG GGG G G G Sbjct: 180 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGG 234 Score = 54.8 bits (126), Expect = 2e-07 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGG-XXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G GG GG GG GGGG GG G G G G GG G G G GG Sbjct: 177 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 236 Query: 585 G 583 G Sbjct: 237 G 237 Score = 52.0 bits (119), Expect = 1e-06 Identities = 49/161 (30%), Positives = 49/161 (30%), Gaps = 6/161 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 174 GGGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGGG--------NG 217 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGG----XGGXXXXXXX 615 G GG G G G G Sbjct: 218 GGGGGRYDRGGGGGGGGGGGNVQPRDGEWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSG 277 Query: 614 GXGXGGXGGXGXGXG--XGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG G G G G G GGGG G GG Sbjct: 278 GGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGG 318 Score = 49.6 bits (113), Expect = 6e-06 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXX--GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG GGG G G GGG G GGG G G G Sbjct: 177 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 233 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GGG GG G G GG G GG GGG Sbjct: 4 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGA-SKDSYNKGPGGYSGGGG 62 Query: 534 XXPXXGGAXXG 502 GG G Sbjct: 63 GGGGGGGGSGG 73 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG G GG + G G G GG GG GGG G G Sbjct: 25 GGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSG 72 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G G G G GGGG G G G G G GG G Sbjct: 7 GGGYDSGSGHRGS---GGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 63 Query: 582 XGXXXXGXGG 553 G G GG Sbjct: 64 GGGGGGGSGG 73 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGG 816 G+G G+GG G GG G GG G GG GGG G GGGGG Sbjct: 13 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGG 70 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G+G G GG G GG + GG G GGGG G GG GG Sbjct: 21 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 73 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXG----AXGXGGGXGGXGGG 536 GGGG GG GGG G G GGG GG GGG Sbjct: 302 GGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGG 345 Score = 32.7 bits (71), Expect = 0.77 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG----------GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G G GG G GGG G GG G G GG GG GGG G Sbjct: 15 GHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 73 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 65.7 bits (153), Expect = 9e-11 Identities = 44/154 (28%), Positives = 44/154 (28%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGG G G GG G G G Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWR 292 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G GG GG GG GGGG G GGG G G Sbjct: 293 NECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGG 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG G GG Sbjct: 353 GGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGG 386 Score = 55.2 bits (127), Expect = 1e-07 Identities = 45/159 (28%), Positives = 45/159 (28%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---XGGXGGGGXXGXGGGGGGXXXXXXX 792 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNV 272 Query: 791 XXXXXXXXXXXXGXXGGPGXG-XGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G G G GG GG Sbjct: 273 QPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDR 332 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G GGGG G GG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 371 Score = 53.6 bits (123), Expect = 4e-07 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G GG G G GG G GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRG-GGGGGGRYDRG---GGGGGGGGGG 270 Query: 537 GXXPXXG 517 P G Sbjct: 271 NVQPRDG 277 Score = 53.2 bits (122), Expect = 5e-07 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 GG GGGG GG G GGG GG G GG G G G GG G GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G G G G GG G GG GGGG GG GGG GG G G G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG GG G G G GG G G G GG GGG GG GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG---GGGRYDRGGGGGGGG 267 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG----XGGXGGG 536 G G GG GG GGGG GGG G G GGG GG GGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGG 265 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -2 Query: 664 GXXGGGGXGG----XXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG GGGG GGG G G GGG GGG G G Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GGG GG G G GG G GG GGG Sbjct: 42 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGG-ASKDSYNKGHGGYSGGGG 100 Query: 534 XXPXXGGAXXGG 499 GG GG Sbjct: 101 GGGGGGGGGSGG 112 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXX 568 G G G GG G GGG GG G G GG G GG G G Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKD--SYNKGHGGYSGGGGGG 102 Query: 567 XGXGGAGXGG 538 G GG G GG Sbjct: 103 GGGGGGGSGG 112 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG G G G GG G G GG G GG GG GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 9/59 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGGG 813 G+G G+GG G GG G GG G GG GGG G GGGGGG Sbjct: 51 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGG 109 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G+G G GG G GG + GG G GGGG G GGG GG Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGG 112 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXG--GPGGGGXGGXXX--GXGXAGGGXG 637 G G G G GG GG G GGGG GG G G GGG G Sbjct: 225 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.1 bits (72), Expect = 0.59 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G GG G G GG GG G G G GG G Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG------GGGGGGGGSGG 112 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GGGG GG GGG G Sbjct: 318 GGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGG 377 Query: 583 XGAXGXGGGXGGXGGG 536 G GG GG Sbjct: 378 GGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G GG G GG GGG GG GGGG GG Sbjct: 350 GGGGGGGGGGGYS--------RFNDNNGGGRGGRGGGGGNRRDGG 386 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 65.7 bits (153), Expect = 9e-11 Identities = 44/154 (28%), Positives = 44/154 (28%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGG G G GG G G G Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWR 292 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G GG GG GG GGGG G GGG G G Sbjct: 293 NECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGG 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG G GG Sbjct: 353 GGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGG 386 Score = 55.2 bits (127), Expect = 1e-07 Identities = 45/159 (28%), Positives = 45/159 (28%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---XGGXGGGGXXGXGGGGGGXXXXXXX 792 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNV 272 Query: 791 XXXXXXXXXXXXGXXGGPGXG-XGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G G G GG GG Sbjct: 273 QPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDR 332 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G GGGG G GG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 371 Score = 53.6 bits (123), Expect = 4e-07 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G GG G G GG G GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRG-GGGGGGRYDRG---GGGGGGGGGG 270 Query: 537 GXXPXXG 517 P G Sbjct: 271 NVQPRDG 277 Score = 53.2 bits (122), Expect = 5e-07 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 GG GGGG GG G GGG GG G GG G G G GG G GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G G G G GG G GG GGGG GG GGG GG G G G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG GG G G G GG G G G GG GGG GG GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG---GGGRYDRGGGGGGGG 267 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG----XGGXGGG 536 G G GG GG GGGG GGG G G GGG GG GGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGG 265 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -2 Query: 664 GXXGGGGXGG----XXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG GGGG GGG G G GGG GGG G G Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GGG GG G G GG G GG GGG Sbjct: 42 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGG-ASKDSYNKGHGGYSGGGG 100 Query: 534 XXPXXGGAXXGG 499 GG GG Sbjct: 101 GGGGGGGGGSGG 112 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXX 568 G G G GG G GGG GG G G GG G GG G G Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKD--SYNKGHGGYSGGGGGG 102 Query: 567 XGXGGAGXGG 538 G GG G GG Sbjct: 103 GGGGGGGSGG 112 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG G G G GG G G GG G GG GG GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 9/59 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGGG 813 G+G G+GG G GG G GG G GG GGG G GGGGGG Sbjct: 51 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGG 109 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G+G G GG G GG + GG G GGGG G GGG GG Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGG 112 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXG--GPGGGGXGGXXX--GXGXAGGGXG 637 G G G G GG GG G GGGG GG G G GGG G Sbjct: 225 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.1 bits (72), Expect = 0.59 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G GG G G GG GG G G G GG G Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG------GGGGGGGGSGG 112 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GGGG GG GGG G Sbjct: 318 GGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGG 377 Query: 583 XGAXGXGGGXGGXGGG 536 G GG GG Sbjct: 378 GGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G GG G GG GGG GG GGGG GG Sbjct: 350 GGGGGGGGGGGYS--------RFNDNNGGGRGGRGGGGGNRRDGG 386 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 65.7 bits (153), Expect = 9e-11 Identities = 44/154 (28%), Positives = 44/154 (28%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGG G G GG G G G Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWR 292 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G GG GG GG GGGG G GGG G G Sbjct: 293 NECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGG 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG G GG Sbjct: 353 GGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGG 386 Score = 55.2 bits (127), Expect = 1e-07 Identities = 45/159 (28%), Positives = 45/159 (28%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---XGGXGGGGXXGXGGGGGGXXXXXXX 792 G G G GG G GG G GGG GG GGGG GGGGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNV 272 Query: 791 XXXXXXXXXXXXGXXGGPGXG-XGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 G G G GG GG Sbjct: 273 QPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDR 332 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG G G G GGGG G GG Sbjct: 333 GSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGG 371 Score = 53.6 bits (123), Expect = 4e-07 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG GG G G G GG G G GG G GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRG-GGGGGGRYDRG---GGGGGGGGGG 270 Query: 537 GXXPXXG 517 P G Sbjct: 271 NVQPRDG 277 Score = 53.2 bits (122), Expect = 5e-07 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 GG GGGG GG G GGG GG G GG G G G GG G GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G G G G GG G GG GGGG GG GGG GG G G G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG GG G G G GG G G G GG GGG GG GG Sbjct: 215 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGG---GGGRYDRGGGGGGGG 267 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG----XGGXGGG 536 G G GG GG GGGG GGG G G GGG GG GGG Sbjct: 219 GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGG 265 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -2 Query: 664 GXXGGGGXGG----XXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG GGGG GGG G G GGG GGG G G Sbjct: 216 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GGG GG G G GG G GG GGG Sbjct: 42 GKQGGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGG-ASKDSYNKGHGGYSGGGG 100 Query: 534 XXPXXGGAXXGG 499 GG GG Sbjct: 101 GGGGGGGGGSGG 112 Score = 40.7 bits (91), Expect = 0.003 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXX 568 G G G GG G GGG GG G G GG G GG G G Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKD--SYNKGHGGYSGGGGGG 102 Query: 567 XGXGGAGXGG 538 G GG G GG Sbjct: 103 GGGGGGGSGG 112 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG G G G GG G G GG G GG GG GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 9/59 (15%) Frame = -1 Query: 962 GAGX-GAGGXGXGGXGXXXXXXXXXXXXRXGG--------GXGGXGGGGXXGXGGGGGG 813 G+G G+GG G GG G GG G GG GGG G GGGGGG Sbjct: 51 GSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGG 109 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGX----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G+G G GG G GG + GG G GGGG G GGG GG Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGG 112 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXG--GPGGGGXGGXXX--GXGXAGGGXG 637 G G G G GG GG G GGGG GG G G GGG G Sbjct: 225 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 33.1 bits (72), Expect = 0.59 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G GG G G GG GG G G G GG G Sbjct: 59 GSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG------GGGGGGGGSGG 112 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GGGG GG GGG G Sbjct: 318 GGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGG 377 Query: 583 XGAXGXGGGXGGXGGG 536 G GG GG Sbjct: 378 GGGNRRDGGPMRNDGG 393 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G GG G GG GGG GG GGGG GG Sbjct: 350 GGGGGGGGGGGYS--------RFNDNNGGGRGGRGGGGGNRRDGG 386 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 64.9 bits (151), Expect = 2e-10 Identities = 43/109 (39%), Positives = 43/109 (39%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G G G G GG Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG--------------RGGFGGG 64 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG GG GGGG GG G G GGG GG Sbjct: 65 RGGGGRGGGGGGGRGAFGGRGGG--GGRGGGGRGGGGRGGGGRGGGAGG 111 Score = 63.7 bits (148), Expect = 4e-10 Identities = 45/116 (38%), Positives = 45/116 (38%), Gaps = 1/116 (0%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXX 696 GGG GG GGGG G GGGGGG GG G G G Sbjct: 18 GGGGGGGGGGGFRGRGGGGGG----------------------GGGGFGGGRGRGGGGDR 55 Query: 695 XXXXXXXXGXGXXGRGGXGGXXXXXXXG-XGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G G GRGG GG G G GG GG G G G G GRGGG G Sbjct: 56 GGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 111 Score = 63.3 bits (147), Expect = 5e-10 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G G GG G G G G GGG GG G G G GG G Sbjct: 34 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGG-GGRGG 92 Query: 582 XGXXXXGXGGAGXGGGXXPXXGG 514 G G GG G GGG GG Sbjct: 93 GGRGGGGRGGGGRGGGAGGFKGG 115 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/88 (40%), Positives = 36/88 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GGG GG G G GG GG G G G GG G Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGG 77 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 78 RGAFGGRGGGGGRGGGG--RGGGGRGGG 103 Score = 62.9 bits (146), Expect = 6e-10 Identities = 38/93 (40%), Positives = 38/93 (40%), Gaps = 5/93 (5%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX-----GX 598 G G G G GG GG GG G G GG G G GGG GG G G G Sbjct: 25 GGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGR 84 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG G GGG G GG Sbjct: 85 GGGGGRGGG--GRGGGGRGGGGRGGGAGGFKGG 115 Score = 57.6 bits (133), Expect = 2e-08 Identities = 30/72 (41%), Positives = 30/72 (41%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG GGGG G G G GGG G G G GG G G G G G GGG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGG 76 Query: 534 XXPXXGGAXXGG 499 GG GG Sbjct: 77 GRGAFGGRGGGG 88 Score = 50.0 bits (114), Expect = 5e-06 Identities = 26/53 (49%), Positives = 26/53 (49%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GRGG GG G G GG GG G G GG GRGGGG G G GG Sbjct: 57 GRGGFGGGRGGG--GRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG 107 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GGG G GG G G GGG GG Sbjct: 62 GGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 111 Score = 46.0 bits (104), Expect = 8e-05 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXG-GXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG G G GG G G G G G GRGGGG G G GG Sbjct: 31 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGG 87 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G G G GG GGGG G G GGG Sbjct: 60 GFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGG 108 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GG GG GGGG G GGGG G Sbjct: 34 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRG 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGG-XGXXXXXGXXXGG 498 RGG GG G GG GG G G G GG GRGGGG G G GG Sbjct: 16 RGGGGGGGGGGGGFRGRGGGGG-GGGGGFGGGRGRGGGGDRGGRGGFGGGRGG 67 Score = 43.6 bits (98), Expect = 4e-04 Identities = 45/137 (32%), Positives = 45/137 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G G G GGG GG GGG G G GGGG Sbjct: 17 GGGGGGGGGGGGFRG-------------RGGGGGGGGGGFGGGRGRGGGG---------- 53 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G GRGG G G Sbjct: 54 -------DRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGG---------GGRGG 97 Query: 602 GGXGGXGXGXGXGGXXG 552 GG GG G G G GG G Sbjct: 98 GGRGGGGRGGGAGGFKG 114 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 64.9 bits (151), Expect = 2e-10 Identities = 43/109 (39%), Positives = 43/109 (39%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G G G G GG Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG--------------RGGFGGG 57 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG GG GGGG GG G G GGG GG Sbjct: 58 RGGGGRGGGGGGGRGAFGGRGGG--GGRGGGGRGGGGRGGGGRGGGAGG 104 Score = 63.7 bits (148), Expect = 4e-10 Identities = 45/116 (38%), Positives = 45/116 (38%), Gaps = 1/116 (0%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXX 696 GGG GG GGGG G GGGGGG GG G G G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGG----------------------GGGGFGGGRGRGGGGDR 48 Query: 695 XXXXXXXXGXGXXGRGGXGGXXXXXXXG-XGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G G GRGG GG G G GG GG G G G G GRGGG G Sbjct: 49 GGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 104 Score = 63.3 bits (147), Expect = 5e-10 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G G GG G G G G GGG GG G G G GG G Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGG-GGRGG 85 Query: 582 XGXXXXGXGGAGXGGGXXPXXGG 514 G G GG G GGG GG Sbjct: 86 GGRGGGGRGGGGRGGGAGGFKGG 108 Score = 62.9 bits (146), Expect = 6e-10 Identities = 36/88 (40%), Positives = 36/88 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GGG GG G G GG GG G G G GG G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGG 70 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG GG Sbjct: 71 RGAFGGRGGGGGRGGGG--RGGGGRGGG 96 Score = 62.9 bits (146), Expect = 6e-10 Identities = 38/93 (40%), Positives = 38/93 (40%), Gaps = 5/93 (5%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX-----GX 598 G G G G GG GG GG G G GG G G GGG GG G G G Sbjct: 18 GGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGR 77 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG G GGG G GG Sbjct: 78 GGGGGRGGG--GRGGGGRGGGGRGGGAGGFKGG 108 Score = 58.8 bits (136), Expect = 1e-08 Identities = 32/80 (40%), Positives = 32/80 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGGG G G G GGG G G G GG G G G Sbjct: 2 GKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG 61 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 G G GGG GG GG Sbjct: 62 GRGGGGGGGRGAFGGRGGGG 81 Score = 50.0 bits (114), Expect = 5e-06 Identities = 26/53 (49%), Positives = 26/53 (49%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GRGG GG G G GG GG G G GG GRGGGG G G GG Sbjct: 50 GRGGFGGGRGGG--GRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG 100 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GGG G GG G G GGG GG Sbjct: 55 GGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 104 Score = 46.0 bits (104), Expect = 8e-05 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXG-GXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG G G GG G G G G G GRGGGG G G GG Sbjct: 24 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGG 80 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G G G GG GGGG G G GGG Sbjct: 53 GFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGG 101 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGG-XGXXXXXGXXXGG 498 G RGG GG G GG GG G G G GG GRGGGG G G GG Sbjct: 5 GFSPRGGGGGGGGGGGGFRGRGGGGG-GGGGGFGGGRGRGGGGDRGGRGGFGGGRGG 60 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GG GG GGGG G GGGG G Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRG 72 Score = 43.6 bits (98), Expect = 4e-04 Identities = 45/137 (32%), Positives = 45/137 (32%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G G G GGG GG GGG G G GGGG Sbjct: 10 GGGGGGGGGGGGFRG-------------RGGGGGGGGGGFGGGRGRGGGG---------- 46 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G G GRGG G G Sbjct: 47 -------DRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGG---------GGRGG 90 Query: 602 GGXGGXGXGXGXGGXXG 552 GG GG G G G GG G Sbjct: 91 GGRGGGGRGGGAGGFKG 107 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 63.3 bits (147), Expect = 5e-10 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 3/91 (3%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXG--GPGGGGXGGXXXGXGXAGGGX-GGXXXXXXGXGXGXGG 592 G G G GG GG G G GGGG GG G G GGG GG G G G Sbjct: 5 GFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGR 64 Query: 591 XXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG G GGG G GG Sbjct: 65 GGGGGRGGGGRGGGGRGGGGRGGGAGGFKGG 95 Score = 55.2 bits (127), Expect = 1e-07 Identities = 32/80 (40%), Positives = 32/80 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGGG G G G GGG G G G GG G G Sbjct: 2 GKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAF 61 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 GG G GGG GG GG Sbjct: 62 GGRGGGGG---RGGGGRGGG 78 Score = 54.4 bits (125), Expect = 2e-07 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 2/78 (2%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA- 550 G G G GGGG GG G GGG GG G G G GG G G GA Sbjct: 2 GKPGFSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAF 61 Query: 549 -GXGGGXXPXXGGAXXGG 499 G GGG GG GG Sbjct: 62 GGRGGGGGRGGGGRGGGG 79 Score = 53.2 bits (122), Expect = 5e-07 Identities = 41/109 (37%), Positives = 41/109 (37%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G G G G GG Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGG--------------------- 50 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG G GG GGGG GG G G AGG GG Sbjct: 51 RGGFGGGRGAFGGRGGGGGRGG---GGRGGGGRGGGGRG-GGAGGFKGG 95 Score = 50.8 bits (116), Expect = 3e-06 Identities = 40/105 (38%), Positives = 40/105 (38%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 RGG GG GGGG G G G G GG G G G Sbjct: 9 RGGGGGGGG--GGGGFRGRGGGGG-GGGGGFGGG-----------------RGRGGGGDR 48 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG GGGG GG G G GGG GG Sbjct: 49 GGRGGFGGGRGAFGGRGGG--GGRGGGGRGGGGRGGGGRGGGAGG 91 Score = 50.8 bits (116), Expect = 3e-06 Identities = 41/109 (37%), Positives = 41/109 (37%), Gaps = 1/109 (0%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXX 696 GGG GG GGGG G GGGGGG GG G G G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGG----------------------GGGGFGGGRGRGGGGDR 48 Query: 695 XXXXXXXXGXG-XXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXG 552 G G GRGG GG G G GG GG G G G GG G Sbjct: 49 GGRGGFGGGRGAFGGRGGGGG---RGGGGRGGGGRGGGGRGGGAGGFKG 94 Score = 44.8 bits (101), Expect = 2e-04 Identities = 27/62 (43%), Positives = 27/62 (43%), Gaps = 6/62 (9%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGX--GGXGGXGXGXGX----GGXXGRGGGGXGXXXXXGXXX 504 G G GG GG G G GG GG G G G GG GRGGGG G G Sbjct: 26 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGR 85 Query: 503 GG 498 GG Sbjct: 86 GG 87 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = -1 Query: 746 GGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGX 567 GG G G G G GRGG G G G G GG G G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGG-- 68 Query: 566 G-GXXGRGGGGXGXXXXXGXXXG 501 G G GRGGGG G G G Sbjct: 69 GRGGGGRGGGGRGGGGRGGGAGG 91 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G G G GGG G GGG G GG GGG Sbjct: 10 GGGGGGGGGGGGFRG--RGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGG 57 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 63.3 bits (147), Expect = 5e-10 Identities = 44/159 (27%), Positives = 44/159 (27%), Gaps = 5/159 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX--PPPAXPXPXX 673 PP PP P P PP P P PP P P PP PP P Sbjct: 289 PPTTRPPATYLPPTNKPLPPVTTRLPPPP--PPPRTPPPTRPPTKPPTTRPPATYLPPTN 346 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX 853 PP P P PP PP P P P PP Sbjct: 347 KPPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTPPPT 406 Query: 854 PXPXXPP---XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P PP P P PPPP P PP Sbjct: 407 KPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 445 Score = 62.5 bits (145), Expect = 8e-10 Identities = 44/157 (28%), Positives = 44/157 (28%), Gaps = 8/157 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PP P P P PP P P PP PPP P PP PP Sbjct: 274 PPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPP 333 Query: 695 ---PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP-XP 862 P PP P P P P PP Sbjct: 334 TTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRT 393 Query: 863 XXPPXPAPXPXPAXPP--PPXXXXXPP--XPPRPXPP 961 P P P P PP PP PP RP PP Sbjct: 394 TVRTTPRPTPPPTKPPTRPPTTYLPPPTVRTTRPPPP 430 Score = 60.9 bits (141), Expect = 3e-09 Identities = 40/151 (26%), Positives = 40/151 (26%), Gaps = 3/151 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P P PP P P PP PP P P Sbjct: 228 PPPPPPPRT--PPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRP 285 Query: 680 PXPPP---PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPP 850 P PP P PP P P P P P Sbjct: 286 PTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPT 345 Query: 851 XPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P P PPPP P P Sbjct: 346 NKPPPPVTTRRPTPPPTRPPPPPTRASTPAP 376 Score = 60.1 bits (139), Expect = 4e-09 Identities = 47/162 (29%), Positives = 47/162 (29%), Gaps = 8/162 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA--PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP P PP P PP P P PP P P PP PPP P Sbjct: 185 PPTRPPTRPPTRPPTRPPTRPPTP----PPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPT 240 Query: 674 XPPXPPP---PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP PP P PP P P P P Sbjct: 241 RPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLP 300 Query: 845 P---PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P P P P PPP P PP PP Sbjct: 301 PTNKPLP-PVTTRLPPPPPPPRTPPP---TRPPTKPPTTRPP 338 Score = 59.3 bits (137), Expect = 8e-09 Identities = 43/154 (27%), Positives = 43/154 (27%), Gaps = 12/154 (7%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPX--PXXXXXXPPXPPPAX------PXPXXXPPXPP 691 PPP P P PP P P PP PPP P P PP Sbjct: 170 PPPDVPFDLPVRTTQPPTRPPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPP 229 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PP PP PP P P P PP P P Sbjct: 230 PPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRP 289 Query: 872 PXPAP----XPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P PP PP PP P P Sbjct: 290 PTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTP 323 Score = 53.6 bits (123), Expect = 4e-07 Identities = 44/179 (24%), Positives = 45/179 (25%), Gaps = 19/179 (10%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP---XPPXPXPXXXXXXXPPSP 648 P PP P P PP PP P P PP P P PP+ Sbjct: 186 PTRPPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTR 245 Query: 649 PRPXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXP---- 816 P P P P P P P Sbjct: 246 PPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKP 305 Query: 817 --------PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPP P PPP PP PP P PP P PP P Sbjct: 306 LPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRP 364 Score = 49.6 bits (113), Expect = 6e-06 Identities = 42/165 (25%), Positives = 42/165 (25%), Gaps = 11/165 (6%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P P P P P P PP PP PP P P Sbjct: 387 PPVTVRTTVRTTPRPTPPPTKPPTRPPTTYLPPPTVRTTRPPP--PPTRPPTKPPTTYLP 444 Query: 680 P--------XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXX 835 P PPP PP PP PP P P Sbjct: 445 PVTVRTTRATPPPTRPPTRPPTYPP-TTRRLTTPAPTYLPPTNKPLPPVTVRTTVRTTPR 503 Query: 836 XXXPPXPXPXXPP---XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P PPPP P PP Sbjct: 504 PTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 548 Score = 48.8 bits (111), Expect = 1e-05 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PS PP PP PP P P P PP PP PPPP P Sbjct: 273 PPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTP 323 Score = 46.8 bits (106), Expect = 4e-05 Identities = 39/158 (24%), Positives = 39/158 (24%), Gaps = 4/158 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXX 676 P PP PP P P P PP P PP P Sbjct: 502 PRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPT 561 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P PP P PP PP P P P PP Sbjct: 562 RPPTRPPTP---PPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTLPPTK 618 Query: 857 XPXXPP---XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P PP P P PPPP P PP Sbjct: 619 PPTRPPTTYLPPPSVRTTRPPPPPTRPPTKPPTTYLPP 656 Score = 45.6 bits (103), Expect = 1e-04 Identities = 41/165 (24%), Positives = 41/165 (24%), Gaps = 11/165 (6%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P P P P P PP PP PP P P Sbjct: 598 PPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPSVRTTRPPP--PPTRPPTKPPTTYLP 655 Query: 680 P--------XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXX 835 P PPP PP PP PP P P Sbjct: 656 PVTVRTTRATPPPTRPPTRPPTYPP-TTRRLTTPAPTYLPPTNKPLPPVTVRTTVRTTPR 714 Query: 836 XXXPPXPXPXXPP---XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P PPPP P PP Sbjct: 715 PTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 759 Score = 45.2 bits (102), Expect = 1e-04 Identities = 41/165 (24%), Positives = 41/165 (24%), Gaps = 11/165 (6%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P P P P P PP PP PP P P Sbjct: 701 PPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPP--PPTRPPTKPPTTYLP 758 Query: 680 P--------XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXX 835 P PPP PP PP PP P P Sbjct: 759 PVTVRTTRATPPPTRPPTRPPTYPP-TTRRLTTPAPTYLPPTNKPLPPVTVRTTVRTTPR 817 Query: 836 XXXPPXPXPXXPP---XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P PPPP P PP Sbjct: 818 PTLPPTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 862 Score = 37.5 bits (83), Expect = 0.027 Identities = 39/156 (25%), Positives = 39/156 (25%), Gaps = 18/156 (11%) Frame = +1 Query: 532 PXPPPPR---PXXPPXPXPXPXPPX--------PPXP----XPXXXXXXXPPSPPR---P 657 P PPPPR P PP P PP PP P P PP P R P Sbjct: 315 PPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRASTP 374 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P PP PPPPP P Sbjct: 375 APTYLPPTNKPLPPVTVRTTVRTTPRPTPPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRP 434 Query: 838 XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PP PP P P PP Sbjct: 435 -PTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPP 469 Score = 34.7 bits (76), Expect = 0.19 Identities = 34/135 (25%), Positives = 34/135 (25%), Gaps = 9/135 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPP--RPXXPPXPX--PXPXPPXPPXPXPXXXXXXXPPSPPR-PXX 663 PP P PPP R PP P P PP P P P R P Sbjct: 718 PPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTR 777 Query: 664 PXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPP----PPP 831 P P P PP PP PPP Sbjct: 778 PPTYPPTTRRLTTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTLPPTRPPTKPPTTYLPPP 837 Query: 832 XPXXPPPPXPPXPPP 876 PP PP PP Sbjct: 838 TVRTTRPPPPPTRPP 852 Score = 34.3 bits (75), Expect = 0.25 Identities = 34/135 (25%), Positives = 34/135 (25%), Gaps = 9/135 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPP--RPXXPPXPX--PXPXPPXPPXPXPXXXXXXXPPSPPR-PXX 663 PP P PPP R PP P P PP P P P R P Sbjct: 615 PPTKPPTRPPTTYLPPPSVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTR 674 Query: 664 PXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPP----PPP 831 P P P PP PP PPP Sbjct: 675 PPTYPPTTRRLTTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPP 734 Query: 832 XPXXPPPPXPPXPPP 876 PP PP PP Sbjct: 735 TVRTTRPPPPPTRPP 749 Score = 33.5 bits (73), Expect = 0.44 Identities = 28/128 (21%), Positives = 29/128 (22%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PPP P P P PP P P + PRP Sbjct: 343 PPTNKPPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPP-TNKPLPPVTVRTTVRTTPRP 401 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P PP PPP P Sbjct: 402 TPPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPP 461 Query: 838 XXPPPPXP 861 PP P Sbjct: 462 TRPPTYPP 469 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PP PP PP P P PPP PPP Sbjct: 847 PPTRPPTKPPTTYLPPVTVVRTTRPPPPPTRRTTVYVPPP 886 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP-------XPPPP 656 P+ PP PPP P PP PP PP PPPP Sbjct: 822 PTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVVRTTRPPPP 874 Score = 30.3 bits (65), Expect = 4.1 Identities = 34/140 (24%), Positives = 34/140 (24%), Gaps = 14/140 (10%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPP--RPXXPPXPX--PXPXPPXPPXPXPXXXXXXXPPSPPRP--- 657 PP P PPP R PP P P PP P P P RP Sbjct: 507 PPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTR 566 Query: 658 ---XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPP-- 822 P P P PP PP Sbjct: 567 PPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTT 626 Query: 823 --PPPXPXXPPPPXPPXPPP 876 PPP PP PP PP Sbjct: 627 YLPPPSVRTTRPPPPPTRPP 646 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXX---PXPPPAPPPPXXXPPXPPP 653 PP PP PP P P PPP PP PP Sbjct: 821 PPTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 862 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXX---PXPPPAPPPPXXXPPXPPP 653 PP PP PP P P PPP PP PP Sbjct: 718 PPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPP 759 Score = 29.5 bits (63), Expect = 7.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 10/53 (18%) Frame = +3 Query: 537 PPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPP-------XPPPPXXP 665 PP PP PPP P PP PP PP PPP P Sbjct: 722 PPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRP 774 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 62.5 bits (145), Expect = 8e-10 Identities = 36/113 (31%), Positives = 36/113 (31%), Gaps = 4/113 (3%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 P PPP P P PP PPP P PP P P P Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP--LPPQKGEHGHHHHHK 207 Query: 815 XXXXXXXXXXPPXPXPXXPPXPA----PXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P P P PPPP P PP P PP Sbjct: 208 GSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPP 260 Score = 60.1 bits (139), Expect = 4e-09 Identities = 37/116 (31%), Positives = 38/116 (32%), Gaps = 2/116 (1%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXP-PSPPR-PXXPXXXXXXXXXXXXX 705 P PPPP PP P P P PP PP P P +PP P Sbjct: 150 PAPPPP----PPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHH 205 Query: 706 XXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPP 873 P PGPP PPPPPP P P PP P PP Sbjct: 206 HKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 261 Score = 56.8 bits (131), Expect = 4e-08 Identities = 43/150 (28%), Positives = 43/150 (28%), Gaps = 1/150 (0%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PPP P PP P P P P P P P Sbjct: 151 APPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSK 210 Query: 692 -PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXX 868 PPGPP P PP P P P PP P P Sbjct: 211 GPPGPPGPPGTGPPGPPGPPGTTYPQ--------------------------PPPPPPPP 244 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PP P P P P Sbjct: 245 PPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Score = 55.2 bits (127), Expect = 1e-07 Identities = 41/149 (27%), Positives = 41/149 (27%), Gaps = 5/149 (3%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXX 693 P P PPPP P P P PP PP P P P P Sbjct: 48 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP-PGLPGTPGPQGPKGHTGSKGERGEKGE 106 Query: 694 XXXXXXXXXXPXPXP-GPPXXXXXXXXXXXXXXXXXXXXXX--PPPPPPXPXXPPPPXPP 864 P P GPP P PPPP P PPPP PP Sbjct: 107 RGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPP 166 Query: 865 XPPPXXXXXXXXXXXXXXP--XPPXPXPP 945 PP P P P PP Sbjct: 167 PPPHSHPHSHHPHPPIVTPPIIVPIPLPP 195 Score = 54.0 bits (124), Expect = 3e-07 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 1/89 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP P PP PP P P PP PP P Sbjct: 180 PPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPP-GTTYPQPP 238 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP PP P P P P P P Sbjct: 239 PPPPPPPPPPPSYPYPPYPYPPPGPYPGP 267 Score = 52.0 bits (119), Expect = 1e-06 Identities = 39/130 (30%), Positives = 40/130 (30%), Gaps = 3/130 (2%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P PP P P P PP PPP P P PP PP P P P Sbjct: 150 PAPPPPPPPPPPP------PPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP----PQKGE 199 Query: 758 XPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX---PXPXXPPXPAPXPXPAXPPPPXXXX 928 PP P P PP P P P P+ P PP Sbjct: 200 HGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPP--YP 257 Query: 929 XPPXPPRPXP 958 PP P P P Sbjct: 258 YPPPGPYPGP 267 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 540 PPXPPXPP----PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PP PP P P P P PPP PPPP PP P P P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYP 257 Score = 49.6 bits (113), Expect = 6e-06 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P G PP P PP P P PP P P P P PPP P P P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPG-PYPGPWIP 270 Query: 683 XP-PPPGP 703 P P P P Sbjct: 271 LPVPVPWP 278 Score = 48.4 bits (110), Expect = 1e-05 Identities = 31/113 (27%), Positives = 33/113 (29%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXX 692 P P PPP PP PPP P + P PP PP P PP Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP-------------- 195 Query: 693 XXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXPPP 851 + P PP P PPP PP PPP Sbjct: 196 -QKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPP 247 Score = 48.0 bits (109), Expect = 2e-05 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPX---PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 G PP P P P P P PP P P P PP PPP P PP P PP Sbjct: 208 GSKGPPGPPGP-PGTGPPGPPGPPGTTYPQPPP------PPPPPPPPPPSYPYPPYPYPP 260 Query: 698 GPPXXPPXXPPXXPXP 745 P P P P P Sbjct: 261 PGPYPGPWIPLPVPVP 276 Score = 47.2 bits (107), Expect = 3e-05 Identities = 36/105 (34%), Positives = 36/105 (34%), Gaps = 18/105 (17%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPP---XPXXXXPXP--XXPP--XPXPXP--------XXXXXXP 637 P PP PPP P PP P P P PP P P P Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGS 209 Query: 638 PXPPPAXPXPXXXPPXPP-PPGP--PXXPPXXPPXXPXPXXXPXP 763 PP P PP PP PPG P PP PP P P P P Sbjct: 210 KGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYP 254 Score = 46.4 bits (105), Expect = 6e-05 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P P P P PP PPP P P P PP P PP P Sbjct: 213 PGPPGPPGTGP----PGPPGPPGTTYPQPPPPPPPPPPPPPSY-PYPPYPYPPPG-PYPG 266 Query: 728 PXXPXPXXXPXP 763 P P P P P Sbjct: 267 PWIPLPVPVPWP 278 Score = 45.6 bits (103), Expect = 1e-04 Identities = 34/125 (27%), Positives = 34/125 (27%), Gaps = 8/125 (6%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPX---PPXPPPXPXAPXXXXXPXPPPAPPPPXXXP--PXPPPPXXP 665 P P S PP PP PPP P P P PP PP P P P P P Sbjct: 35 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGPKGH 94 Query: 666 XXXXXXXXXXXXXXXXXXXXXPXXRXPXXP---PXPXXXXXXXXXXXXXXXXXXXPPPXP 836 P P P P P P P P Sbjct: 95 TGSKGERGEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPP 154 Query: 837 PXPPP 851 P PPP Sbjct: 155 PPPPP 159 Score = 45.2 bits (102), Expect = 1e-04 Identities = 33/132 (25%), Positives = 33/132 (25%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PP P PP P P P P P S Sbjct: 48 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP------KGHTGSKGER 101 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P PGPP PPPPPP P Sbjct: 102 GEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPP 161 Query: 838 XXPPPPXPPXPP 873 PPPP P P Sbjct: 162 PPPPPPPPHSHP 173 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP-PPPXXXPPXPPP 653 P P + PPP PP PPP P P P PPP P P P P P P Sbjct: 226 PPGPPGTTYPQPPPPPPPPPPPPPSYP-YPPYPYPPPGPYPGPWIPLPVPVP 276 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSP 648 P P P PPPP P PP P P PP P P P P P P Sbjct: 224 PGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +3 Query: 501 PXXXPXPSXXXXP-PPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP PPP P P P P PP P P P P P P Sbjct: 223 PPGPPGPPGTTYPQPPPPPPPPP-PPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 278 Score = 36.3 bits (80), Expect = 0.063 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP--PXPPXPXPXXXXXXXPPSP- 648 P P P P P+P PP P P P P P PP P P PP P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYP-------PPGPY 264 Query: 649 PRPXXP 666 P P P Sbjct: 265 PGPWIP 270 Score = 35.9 bits (79), Expect = 0.083 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-PXPPPAXPXPXX 673 PP PP P P PP P P P PP P P P P P P P P Sbjct: 218 PPGTGPPGPPGPPGTTYPQPPPP---PPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Query: 674 XP 679 P Sbjct: 275 VP 276 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 884 PXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PPPP PP PP P P Sbjct: 54 PPPPPPPPPPPQHCNCPPGPPGPPGP 79 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 PP P PPPP P P P P P P PP P P P P Sbjct: 229 PPGTTYPQPPPPPPPPP-PPPPSYPYP-PYPYPPPGPYPGPWIPLPVPVP 276 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 826 PPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PP PPPP PP PPP P P P P P Sbjct: 48 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP-PGLPGTPGP 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 32/133 (24%), Positives = 32/133 (24%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P P P PP P P PP PP P Sbjct: 157 PPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP-QKGEHGHHHHHKGSKGPPGP 215 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P P P PP PPP P P Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPP---------------------PPPPSYPYP 254 Query: 838 XXPPPPXPPXPPP 876 P PP P P P Sbjct: 255 PYPYPPPGPYPGP 267 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P PAP PP PP PP P PP Sbjct: 35 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPP 64 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P PP P P P P P Sbjct: 54 PPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 823 PPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXP-XPPXPXPPAP 951 PP PPPP PP PP P P P P P Sbjct: 48 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 62.5 bits (145), Expect = 8e-10 Identities = 36/113 (31%), Positives = 36/113 (31%), Gaps = 4/113 (3%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 P PPP P P PP PPP P PP P P P Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIP--LPPQKGEHGHHHHHK 209 Query: 815 XXXXXXXXXXPPXPXPXXPPXPA----PXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P P P PPPP P PP P PP Sbjct: 210 GSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPP 262 Score = 60.1 bits (139), Expect = 4e-09 Identities = 37/116 (31%), Positives = 38/116 (32%), Gaps = 2/116 (1%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXP-PSPPR-PXXPXXXXXXXXXXXXX 705 P PPPP PP P P P PP PP P P +PP P Sbjct: 152 PAPPPP----PPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHH 207 Query: 706 XXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPP 873 P PGPP PPPPPP P P PP P PP Sbjct: 208 HKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 263 Score = 56.8 bits (131), Expect = 4e-08 Identities = 43/150 (28%), Positives = 43/150 (28%), Gaps = 1/150 (0%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PPP P PP P P P P P P P Sbjct: 153 APPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSK 212 Query: 692 -PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXX 868 PPGPP P PP P P P PP P P Sbjct: 213 GPPGPPGPPGTGPPGPPGPPGTTYPQ--------------------------PPPPPPPP 246 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PP P P P P Sbjct: 247 PPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Score = 55.2 bits (127), Expect = 1e-07 Identities = 41/149 (27%), Positives = 41/149 (27%), Gaps = 5/149 (3%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXX 693 P P PPPP P P P PP PP P P P P Sbjct: 50 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP-PGLPGTPGPQGPKGHTGSKGERGEKGE 108 Query: 694 XXXXXXXXXXPXPXP-GPPXXXXXXXXXXXXXXXXXXXXXX--PPPPPPXPXXPPPPXPP 864 P P GPP P PPPP P PPPP PP Sbjct: 109 RGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPPPPP 168 Query: 865 XPPPXXXXXXXXXXXXXXP--XPPXPXPP 945 PP P P P PP Sbjct: 169 PPPHSHPHSHHPHPPIVTPPIIVPIPLPP 197 Score = 54.0 bits (124), Expect = 3e-07 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 1/89 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP P PP PP P P PP PP P Sbjct: 182 PPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPP-GTTYPQPP 240 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP PP P P P P P P Sbjct: 241 PPPPPPPPPPPSYPYPPYPYPPPGPYPGP 269 Score = 52.0 bits (119), Expect = 1e-06 Identities = 39/130 (30%), Positives = 40/130 (30%), Gaps = 3/130 (2%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P PP P P P PP PPP P P PP PP P P P Sbjct: 152 PAPPPPPPPPPPP------PPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP----PQKGE 201 Query: 758 XPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX---PXPXXPPXPAPXPXPAXPPPPXXXX 928 PP P P PP P P P P+ P PP Sbjct: 202 HGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPP--YP 259 Query: 929 XPPXPPRPXP 958 PP P P P Sbjct: 260 YPPPGPYPGP 269 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 540 PPXPPXPP----PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PP PP P P P P PPP PPPP PP P P P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYP 259 Score = 49.6 bits (113), Expect = 6e-06 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P G PP P PP P P PP P P P P PPP P P P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPG-PYPGPWIP 272 Query: 683 XP-PPPGP 703 P P P P Sbjct: 273 LPVPVPWP 280 Score = 48.4 bits (110), Expect = 1e-05 Identities = 31/113 (27%), Positives = 33/113 (29%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXX 692 P P PPP PP PPP P + P PP PP P PP Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP-------------- 197 Query: 693 XXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXPPP 851 + P PP P PPP PP PPP Sbjct: 198 -QKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPP 249 Score = 48.0 bits (109), Expect = 2e-05 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPX---PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 G PP P P P P P PP P P P PP PPP P PP P PP Sbjct: 210 GSKGPPGPPGP-PGTGPPGPPGPPGTTYPQPPP------PPPPPPPPPPSYPYPPYPYPP 262 Query: 698 GPPXXPPXXPPXXPXP 745 P P P P P Sbjct: 263 PGPYPGPWIPLPVPVP 278 Score = 47.2 bits (107), Expect = 3e-05 Identities = 36/105 (34%), Positives = 36/105 (34%), Gaps = 18/105 (17%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPP---XPXXXXPXP--XXPP--XPXPXP--------XXXXXXP 637 P PP PPP P PP P P P PP P P P Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGS 211 Query: 638 PXPPPAXPXPXXXPPXPP-PPGP--PXXPPXXPPXXPXPXXXPXP 763 PP P PP PP PPG P PP PP P P P P Sbjct: 212 KGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYP 256 Score = 46.4 bits (105), Expect = 6e-05 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P P P P PP PPP P P P PP P PP P Sbjct: 215 PGPPGPPGTGP----PGPPGPPGTTYPQPPPPPPPPPPPPPSY-PYPPYPYPPPG-PYPG 268 Query: 728 PXXPXPXXXPXP 763 P P P P P Sbjct: 269 PWIPLPVPVPWP 280 Score = 45.6 bits (103), Expect = 1e-04 Identities = 34/125 (27%), Positives = 34/125 (27%), Gaps = 8/125 (6%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPX---PPXPPPXPXAPXXXXXPXPPPAPPPPXXXP--PXPPPPXXP 665 P P S PP PP PPP P P P PP PP P P P P P Sbjct: 37 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGPKGH 96 Query: 666 XXXXXXXXXXXXXXXXXXXXXPXXRXPXXP---PXPXXXXXXXXXXXXXXXXXXXPPPXP 836 P P P P P P P P Sbjct: 97 TGSKGERGEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPP 156 Query: 837 PXPPP 851 P PPP Sbjct: 157 PPPPP 161 Score = 45.2 bits (102), Expect = 1e-04 Identities = 33/132 (25%), Positives = 33/132 (25%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PP P PP P P P P P S Sbjct: 50 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP------KGHTGSKGER 103 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P PGPP PPPPPP P Sbjct: 104 GEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPP 163 Query: 838 XXPPPPXPPXPP 873 PPPP P P Sbjct: 164 PPPPPPPPHSHP 175 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP-PPPXXXPPXPPP 653 P P + PPP PP PPP P P P PPP P P P P P P Sbjct: 228 PPGPPGTTYPQPPPPPPPPPPPPPSYP-YPPYPYPPPGPYPGPWIPLPVPVP 278 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSP 648 P P P PPPP P PP P P PP P P P P P P Sbjct: 226 PGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +3 Query: 501 PXXXPXPSXXXXP-PPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP PPP P P P P PP P P P P P P Sbjct: 225 PPGPPGPPGTTYPQPPPPPPPPP-PPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 280 Score = 36.3 bits (80), Expect = 0.063 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP--PXPPXPXPXXXXXXXPPSP- 648 P P P P P+P PP P P P P P PP P P PP P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYP-------PPGPY 266 Query: 649 PRPXXP 666 P P P Sbjct: 267 PGPWIP 272 Score = 35.9 bits (79), Expect = 0.083 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXP-PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-PXPPPAXPXPXX 673 PP PP P P PP P P P PP P P P P P P P P Sbjct: 220 PPGTGPPGPPGPPGTTYPQPPPP---PPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Query: 674 XP 679 P Sbjct: 277 VP 278 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 884 PXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PPPP PP PP P P Sbjct: 56 PPPPPPPPPPPQHCNCPPGPPGPPGP 81 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 PP P PPPP P P P P P P PP P P P P Sbjct: 231 PPGTTYPQPPPPPPPPP-PPPPSYPYP-PYPYPPPGPYPGPWIPLPVPVP 278 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 826 PPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PP PPPP PP PPP P P P P P Sbjct: 50 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP-PGLPGTPGP 90 Score = 31.5 bits (68), Expect = 1.8 Identities = 32/133 (24%), Positives = 32/133 (24%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P P P PP P P PP PP P Sbjct: 159 PPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPP-QKGEHGHHHHHKGSKGPPGP 217 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P P P PP PPP P P Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPP---------------------PPPPSYPYP 256 Query: 838 XXPPPPXPPXPPP 876 P PP P P P Sbjct: 257 PYPYPPPGPYPGP 269 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P PAP PP PP PP P PP Sbjct: 37 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPP 66 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P PP P P P P P Sbjct: 56 PPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 823 PPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXP-XPPXPXPPAP 951 PP PPPP PP PP P P P P P Sbjct: 50 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 62.1 bits (144), Expect = 1e-09 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP P P P P PP P P P PP PPP P P Sbjct: 470 PHAVAPP-----PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 524 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 525 PPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P PP P P P P PPP P P PPPP P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 535 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 536 GGIPPPPPPMSASP 549 Score = 58.8 bits (136), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP PPP P P PPP PPPP PPPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPPXPXPXXXXXXXPPSPP 651 P PP P PPPP P PP P P P PP P P PP PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 652 RP 657 P Sbjct: 530 AP 531 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 814 PPPPPPXP-----XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P PPPP PP PPP P PP P PP P P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP PP PPPP PP PP P P P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P P P PP PPP P P PP G P PP PP P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPP---PPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P PPPP PP PP P P P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P PPPP P PP P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXX-----PPXPXPXP---XPPXPPXPXPXXXXXXXPPSPP 651 P P PPPP P PP P P P P PP P P PP PP Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPX-----PAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P P PPPP PP P PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 493 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 37.5 bits (83), Expect = 0.027 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P PP P P P P A PP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLA--------------------NYGAPPPPP 514 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P P PP PP P Sbjct: 515 PPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 563 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P PP P P PPPP PP PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P PP PP PP P PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPP 500 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 835 PXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP PPP P PP P PP P P Sbjct: 470 PHAVAPPPPPPPPP-------LHAFVAPPPPPPPPPPPPPP 503 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 510 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 550 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 62.1 bits (144), Expect = 1e-09 Identities = 51/150 (34%), Positives = 52/150 (34%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GG GGGG G G G GG G GG Sbjct: 55 GSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGG-GWSSGGGGGGWSSGGGGGSGSDVKLIK 113 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG G GG GG GG G G +GGG G Sbjct: 114 IISLGGGGGGHSGGG--GGWSSG--GGGGGWSSGG-SGGHGSSGGGDTKVIKIIKLSSGG 168 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 GG G G G GG G GGG P G A Sbjct: 169 HGGAGGGG----GHGGGG-GGGWQPAGGWA 193 Score = 56.0 bits (129), Expect = 7e-08 Identities = 48/165 (29%), Positives = 49/165 (29%), Gaps = 15/165 (9%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGG-XXGXGGGGGGXXXXXXXXX 786 G G +GG G GG G G GG GGGG G GGGGGG Sbjct: 26 GGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGGGGWSSGGGGGG 85 Query: 785 XXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXG----RGGXGGXXXXXX 618 G G G G G G G GG GG Sbjct: 86 GGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGGGGHSGGGGGWSSGGGGGGWSSGGS 145 Query: 617 XGXGXGGXG----------GXGXGXGXGGXXGRGGGGXGXXXXXG 513 G G G G G G GG G GGGG G G Sbjct: 146 GGHGSSGGGDTKVIKIIKLSSGGHGGAGGGGGHGGGGGGGWQPAG 190 Score = 55.6 bits (128), Expect = 1e-07 Identities = 42/146 (28%), Positives = 45/146 (30%) Frame = -3 Query: 936 GGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGX 757 GG GG +G G +G GG G G GG G Sbjct: 15 GGGSSWSSGG--SGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGG 72 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 G G G G GG G GGG GG G G G G G G GG G G Sbjct: 73 G---GGGWSSGGGGGGGGWSSGGGGGGWSSGGG-GGSGSDVKLIKIISLGGGGGGHSGGG 128 Query: 576 XXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G+ GG Sbjct: 129 GGWSSGGGGGGWSSGGSGGHGSSGGG 154 Score = 50.8 bits (116), Expect = 3e-06 Identities = 40/148 (27%), Positives = 43/148 (29%) Frame = -3 Query: 945 GGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGA 766 GG GGG + +G GG G G GG Sbjct: 15 GGGSSWSSGGSGGGWS-----SGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSG 69 Query: 765 XGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G G G GG G GGG GG G G G G G G Sbjct: 70 GGGG---GGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGGGGHSG 126 Query: 585 GXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G G GG G G G + G Sbjct: 127 GGGGWSSGGGGGGWSSGGSGGHGSSGGG 154 Score = 45.2 bits (102), Expect = 1e-04 Identities = 45/170 (26%), Positives = 46/170 (27%), Gaps = 21/170 (12%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAG----------XGGXXGXGXGGXXXXXXXXXXX 811 GG GG GG G G G G G G G GG Sbjct: 15 GGGSSWSSGGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGG 74 Query: 810 XXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGGXXG-------GPGGGGXGGXXXGXGXA 652 + G G GG G G GGGG G G Sbjct: 75 GGWSSGGGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGGGGHSGGGGGWSSG 134 Query: 651 GGGXGGXXXXXXGXGXGXGGXXG----XGXXXXGXGGAGXGGGXXPXXGG 514 GGG G G G GG G GGAG GGG GG Sbjct: 135 GGGGGWSSGGSGGHGSSGGGDTKVIKIIKLSSGGHGGAGGGGGHGGGGGG 184 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 62.1 bits (144), Expect = 1e-09 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP P P P P PP P P P PP PPP P P Sbjct: 480 PHAVAPP-----PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 534 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 535 PPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P PP P P P P PPP P P PPPP P Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 545 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 546 GGIPPPPPPMSASP 559 Score = 58.8 bits (136), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP PPP P P PPP PPPP PPPP P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPPXPXPXXXXXXXPPSPP 651 P PP P PPPP P PP P P P PP P P PP PP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Query: 652 RP 657 P Sbjct: 540 AP 541 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 814 PPPPPPXP-----XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P PPPP PP PPP P PP P PP P P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP PP PPPP PP PP P P P P Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 528 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P P P PP PPP P P PP G P PP PP P P Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPP---PPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P PPPP PP PP P P P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 527 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P PPPP P PP P PP Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 528 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXX-----PPXPXPXP---XPPXPPXPXPXXXXXXXPPSPP 651 P P PPPP P PP P P P P PP P P PP PP Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 553 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPX-----PAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P P PPPP PP P PP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 527 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 503 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 37.5 bits (83), Expect = 0.027 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P PP P P P P A PP P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLA--------------------NYGAPPPPP 524 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P P PP PP P Sbjct: 525 PPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 522 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 573 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P PP P P PPPP PP PP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 513 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P PP PP PP P PP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPP 510 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 835 PXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP PPP P PP P PP P P Sbjct: 480 PHAVAPPPPPPPPP-------LHAFVAPPPPPPPPPPPPPP 513 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 520 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 560 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 62.1 bits (144), Expect = 1e-09 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP P P P P PP P P P PP PPP P P Sbjct: 470 PHAVAPP-----PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 524 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 525 PPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P PP P P P P PPP P P PPPP P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 535 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 536 GGIPPPPPPMSASP 549 Score = 58.8 bits (136), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP PPP P P PPP PPPP PPPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPPXPXPXXXXXXXPPSPP 651 P PP P PPPP P PP P P P PP P P PP PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 652 RP 657 P Sbjct: 530 AP 531 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 814 PPPPPPXP-----XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P PPPP PP PPP P PP P PP P P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP PP PPPP PP PP P P P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P P P PP PPP P P PP G P PP PP P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPP---PPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P PPPP PP PP P P P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P PPPP P PP P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXX-----PPXPXPXP---XPPXPPXPXPXXXXXXXPPSPP 651 P P PPPP P PP P P P P PP P P PP PP Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPX-----PAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P P PPPP PP P PP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 493 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 37.5 bits (83), Expect = 0.027 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P PP P P P P A PP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLA--------------------NYGAPPPPP 514 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P P PP PP P Sbjct: 515 PPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 563 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P PP P P PPPP PP PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P PP PP PP P PP Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPP 500 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 835 PXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP PPP P PP P PP P P Sbjct: 470 PHAVAPPPPPPPPP-------LHAFVAPPPPPPPPPPPPPP 503 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 510 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 550 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 62.1 bits (144), Expect = 1e-09 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP P P P P PP P P P PP PPP P P Sbjct: 628 PHAVAPP-----PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 682 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 683 PPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P PP P P P P PPP P P PPPP P Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 693 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 694 GGIPPPPPPMSASP 707 Score = 58.8 bits (136), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP PPP P P PPP PPPP PPPP P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPPXPXPXXXXXXXPPSPP 651 P PP P PPPP P PP P P P PP P P PP PP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Query: 652 RP 657 P Sbjct: 688 AP 689 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 814 PPPPPPXP-----XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P PPPP PP PPP P PP P PP P P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP PP PPPP PP PP P P P P Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 676 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P P P PP PPP P P PP G P PP PP P P Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPP---PPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P PPPP PP PP P P P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 675 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P PPPP P PP P PP Sbjct: 638 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 676 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXX-----PPXPXPXP---XPPXPPXPXPXXXXXXXPPSPP 651 P P PPPP P PP P P P P PP P P PP PP Sbjct: 648 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 701 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPX-----PAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P P PPPP PP P PP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 675 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 651 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 37.5 bits (83), Expect = 0.027 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P PP P P P P A PP P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLA--------------------NYGAPPPPP 672 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P P PP PP P Sbjct: 673 PPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 670 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 721 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P PP P P PPPP PP PP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 661 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P PP PP PP P PP Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPP 658 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 835 PXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP PPP P PP P PP P P Sbjct: 628 PHAVAPPPPPPPPP-------LHAFVAPPPPPPPPPPPPPP 661 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 668 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 708 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 62.1 bits (144), Expect = 1e-09 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P APP PPP P P P P PP P P P PP PPP P P Sbjct: 575 PHAVAPP-----PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP 629 Query: 680 PXPPP---PGPPXXPPXXPPXXPXP 745 P PPP G PP PP P Sbjct: 630 PPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 62.1 bits (144), Expect = 1e-09 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P PP P P PP P P P P PPP P P PPPP P Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 640 Query: 716 PXXPPXXPXPXXXP 757 PP P P Sbjct: 641 GGIPPPPPPMSASP 654 Score = 58.8 bits (136), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP PPP P P PPP PPPP PPPP P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPPXPXPXXXXXXXPPSPP 651 P PP P PPPP P PP P P P PP P P PP PP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Query: 652 RP 657 P Sbjct: 635 AP 636 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 814 PPPPPPXP-----XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPP----XPXPPAPXP 957 PPPPPP P PPPP PP PPP P PP P PP P P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 45.6 bits (103), Expect = 1e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP PP PPPP PP PP P P P P Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 623 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P P P PP PPP P P PP G P PP PP P P Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPP---PPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P P PPPP PP PP P P P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 622 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P PPPP P PP P PP Sbjct: 585 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 623 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXX-----PPXPXPXP---XPPXPPXPXPXXXXXXXPPSPP 651 P P PPPP P PP P P P P PP P P PP PP Sbjct: 595 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 648 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 848 PXPXPXXPPX-----PAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P P PPPP PP P PP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 622 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPPPPPXPXXP------PPPXPPXPP-----PXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP P P PPP PP PP P P PP P +P Sbjct: 598 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 37.5 bits (83), Expect = 0.027 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P PP P P P P A PP P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLA--------------------NYGAPPPPP 619 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P P PP PP P Sbjct: 620 PPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP PP G PPP P P P PP P P PA Sbjct: 617 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 668 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P PP P P PPPP PP PP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 608 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P AP P P PP PP PP P PP Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPP 605 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 835 PXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP PPP P PP P PP P P Sbjct: 575 PHAVAPPPPPPPPP-------LHAFVAPPPPPPPPPPPPPP 608 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPPP PPP PPP P PP P+ Sbjct: 615 PPPPPP----PPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPS 655 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 60.9 bits (141), Expect = 3e-09 Identities = 43/144 (29%), Positives = 43/144 (29%), Gaps = 5/144 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPP-PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPX 670 P PP PP P PP P P P P P P P PPP P Sbjct: 385 PQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPPQK 444 Query: 671 XXPPXPP--PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP P PP P PP P P P P P Sbjct: 445 YLPPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLP 504 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPP 916 PP P PP P P P PP P Sbjct: 505 PPV-IPTSPPVPKYLP-PTNPPTP 526 Score = 57.2 bits (132), Expect = 3e-08 Identities = 44/155 (28%), Positives = 44/155 (28%), Gaps = 4/155 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP P PP P P P PP P P PP P P Sbjct: 379 PPPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLP------PPQPKSGYDYPKPA 432 Query: 677 PPXPPPPGPP--XXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPP 850 P PPP PP PP P P P P P P Sbjct: 433 IPFPPPTNPPQKYLPPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAI-P 491 Query: 851 XPXPXXPPXP-APXPXPAXPPPPXXXXXPPXPPRP 952 P P PP P P PP P PP P Sbjct: 492 FPAPTNPPQKYLPPPVIPTSPPVPKYLPPTNPPTP 526 Score = 54.0 bits (124), Expect = 3e-07 Identities = 40/143 (27%), Positives = 41/143 (28%), Gaps = 2/143 (1%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPP--XX 712 PP APP P P P P PP P P PPP PP Sbjct: 186 PPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYL 245 Query: 713 PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXP 892 PP P P P P P P P PP AP P Sbjct: 246 PPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDY------------PKPAIPFPPPTAP-P 292 Query: 893 XPAXPPPPXXXXXPPXPPRPXPP 961 PP PP PP+ PP Sbjct: 293 QKYLPPVTTTQAPPPPPPKYLPP 315 Score = 54.0 bits (124), Expect = 3e-07 Identities = 42/154 (27%), Positives = 42/154 (27%), Gaps = 6/154 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXP----PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 PP APP P P PP P P P P PPP P Sbjct: 332 PPPTAPPQKYLPPVTTTKAPPPPPTVKYLPPPQVKQGYDYPKPAV-----PFPPPTNPPQ 386 Query: 668 XXXPPXPP--PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXX 841 PP P PP P PP P P P P P Sbjct: 387 KYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPPQKYL 446 Query: 842 XPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P P P P PP P PP P Sbjct: 447 PPVVPTSPPQPKYLPPPKPTNPPQP-KYLPPPQP 479 Score = 50.4 bits (115), Expect = 4e-06 Identities = 46/167 (27%), Positives = 46/167 (27%), Gaps = 13/167 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA---PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP P PP P PP P P P P P P PP P Sbjct: 240 PPQKYLPPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPV 299 Query: 671 XXPPXPPPPGPPXXPPXXPP---XXPXP-XXXPXPXAXXXXXXXXXXXXXXXXXXXXXXX 838 PPPP P PP P P P P A Sbjct: 300 TTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTKAPPPPPTVKY 359 Query: 839 XXPPXPXPXXP-PXPA-PXPXPAXPP----PPXXXXXPPXPPRPXPP 961 PP P PA P P P PP PP PP P PP Sbjct: 360 LPPPQVKQGYDYPKPAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPP 406 Score = 49.6 bits (113), Expect = 6e-06 Identities = 41/159 (25%), Positives = 42/159 (26%), Gaps = 5/159 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXX 673 PP APP PP P P P P P P P PPP P Sbjct: 186 PPPTAPPQK-YLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKY 244 Query: 674 XPPXPP--PPGPPXXPPXXPPXXPXPXXXP-XPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP P PP P PP P P P Sbjct: 245 LPPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQA 304 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P P PP+ P Sbjct: 305 PPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLP 343 Score = 48.8 bits (111), Expect = 1e-05 Identities = 42/150 (28%), Positives = 43/150 (28%), Gaps = 10/150 (6%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXX-PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPG---PPX 709 P PA P P P PP P PP P P P PP P G P Sbjct: 372 PKPAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKP 431 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP-PXPA- 883 P PP P P P PP P P PA Sbjct: 432 AIPFPPPTNPPQKYLP-PVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAI 490 Query: 884 PXPXPAXPP----PPXXXXXPPXPPRPXPP 961 P P P PP PP P P+ PP Sbjct: 491 PFPAPTNPPQKYLPPPVIPTSPPVPKYLPP 520 Score = 48.0 bits (109), Expect = 2e-05 Identities = 45/161 (27%), Positives = 45/161 (27%), Gaps = 15/161 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP----PXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAX 658 PP PP PPP P P P P PP P PP P PP Sbjct: 205 PPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKY-LPPVVPTSPPVPKYVPP-- 261 Query: 659 PXPXXXPPXPPPPG---PPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXX 829 P P PP P G P P PP P P Sbjct: 262 PTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQG 321 Query: 830 XXXXXP--PXPXPXXPP---XPAPXPXPAXPPPPXXXXXPP 937 P P P P PP P A PPPP PP Sbjct: 322 YDYPKPAIPFPPPTAPPQKYLPPVTTTKAPPPPPTVKYLPP 362 Score = 47.6 bits (108), Expect = 3e-05 Identities = 41/157 (26%), Positives = 41/157 (26%), Gaps = 3/157 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-PXPPPAXPXPXXX 676 P PP PP P P P P PP P P P PA P P Sbjct: 493 PAPTNPPQKYLPPPVIPTSPPVPKYLP-PTNPPTPQYLPPVQVKQGYDYPKPAIPFP--- 548 Query: 677 PPXPPPPG--PPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPP 850 PP PP PP PP P P PP Sbjct: 549 PPTAPPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPP 608 Query: 851 XPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PP P P P PP Sbjct: 609 VTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPP 645 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/167 (25%), Positives = 42/167 (25%), Gaps = 16/167 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P PP PPP P P PP P P PP P P Sbjct: 406 PKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPQPKYLPPPKP 465 Query: 680 PXPPPPG--PPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPX 853 PP P PP P P P PP Sbjct: 466 TNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLPPPVIPTSPPVPKYLPPTNPPT 525 Query: 854 PXPXXP---------PXPA-PXPXPAXPP----PPXXXXXPPXPPRP 952 P P P PA P P P PP PP P PP P Sbjct: 526 PQYLPPVQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 572 Score = 43.2 bits (97), Expect = 5e-04 Identities = 36/146 (24%), Positives = 37/146 (25%), Gaps = 4/146 (2%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPP--X 709 P P P P P P P P PP P P PPP PP Sbjct: 546 PFPPPTAPPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKY 605 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P P + P P P Sbjct: 606 LPPVTTTQAPPP---PPPTSKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYIPPVVPTSP 662 Query: 890 PXPAXPPPP--XXXXXPPXPPRPXPP 961 P P PPP P P P PP Sbjct: 663 PTPKYLPPPQVKQGYDYPKPVIPFPP 688 Score = 42.3 bits (95), Expect = 0.001 Identities = 38/165 (23%), Positives = 40/165 (24%), Gaps = 12/165 (7%) Frame = +1 Query: 499 PPXXXPXXXXXPX----PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP--- 657 PP P P PP P+ PP P P P P P P P+ P P Sbjct: 437 PPTNPPQKYLPPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPT 496 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P P P PP PP Sbjct: 497 NPPQKYLPPPVIPTSPPVPKYLPPTNPPTPQYLPPVQVKQGYDYPKPAIPFPPPTAPPQK 556 Query: 838 XXPP-----PPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP P PP P P P P PP P Sbjct: 557 YLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAP 601 Score = 40.3 bits (90), Expect = 0.004 Identities = 46/175 (26%), Positives = 47/175 (26%), Gaps = 25/175 (14%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXP-PXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PP PP P P P P P P PPPA P Sbjct: 104 PPPTQPPQIRVTSPPVAE----GYAYPTPSVPFPQPKQGYDYPKPAVPFPPPAVPTQKYL 159 Query: 677 PPX-----PPP----------PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXX 811 PP PPP P P PP PP P P A Sbjct: 160 PPVTTTQAPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTP-APPPPPPPTKKYLPP 218 Query: 812 XXXXXXXXXXXP--PXPXPXXPP-------XPAPXPXPAXPPPPXXXXXPPXPPR 949 P P P P PP P P P PPP PP P + Sbjct: 219 PQVKQGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPVPKYVPPPTPTYIPPPPKK 273 Score = 39.5 bits (88), Expect = 0.007 Identities = 34/134 (25%), Positives = 36/134 (26%), Gaps = 9/134 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPX----PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPS-P-PRPX 660 PP P P PP P+ PP P P P P P P P+ P P P Sbjct: 380 PPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPT 439 Query: 661 XPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXP---PPPPP 831 P P P P P P P PP Sbjct: 440 NPPQKYLPPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPP 499 Query: 832 XPXXPPPPXPPXPP 873 PPP P PP Sbjct: 500 QKYLPPPVIPTSPP 513 Score = 37.1 bits (82), Expect = 0.036 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 7/80 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXP-----PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPX 664 PP APP P P P PP P P P P PPP P Sbjct: 596 PPPTAPPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAI-----PFPPPTNPP 650 Query: 665 PXXXPPXPP--PPGPPXXPP 718 PP P PP P PP Sbjct: 651 QKYIPPVVPTSPPTPKYLPP 670 Score = 35.9 bits (79), Expect = 0.083 Identities = 32/141 (22%), Positives = 32/141 (22%), Gaps = 1/141 (0%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P P P P P P P P P P PP P Sbjct: 97 PKPVVPFPPPTQPPQIRVTSP-PVAEGYAYPTPSVPFPQPKQGYDYPKPAVPFPPPAVPT 155 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPA 901 P P PP PP P P Sbjct: 156 QKYLPPVTTTQAPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKY 215 Query: 902 XPPPPXXXXXP-PXPPRPXPP 961 PPP P P P PP Sbjct: 216 LPPPQVKQGYDYPKPAIPFPP 236 Score = 35.9 bits (79), Expect = 0.083 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXP 647 P PP PP P P PPP PPP P P Sbjct: 184 PFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPP 219 Score = 34.7 bits (76), Expect = 0.19 Identities = 38/165 (23%), Positives = 38/165 (23%), Gaps = 9/165 (5%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P P P PP P P P P P P P P Sbjct: 228 PKPAIPFPPPTNPPQKYLPPVVPT---SPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAIP 284 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 P P P PP PP PP Sbjct: 285 FPP----PTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPPQK 340 Query: 838 XXPP------PPXPPXP---PPXXXXXXXXXXXXXXPXPPXPXPP 945 PP PP PP PP P PP PP Sbjct: 341 YLPPVTTTKAPPPPPTVKYLPPPQVKQGYDYPKPAVPFPPPTNPP 385 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +3 Query: 513 PXPSXXXXPPPXPP---XPPPXPXAPXXXXXPXPPPAPPPPXXXPPXP---PPP 656 P P+ PP PP PP P P P P PPP PP P PPP Sbjct: 372 PKPAVPFPPPTNPPQKYLPPVVPTTP-----PQPKYLPPPKPTNPPQPKYLPPP 420 Score = 33.5 bits (73), Expect = 0.44 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 4/86 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P PP PP PP P P P P P PA P P P Sbjct: 591 PAIPFPPPTA--PPQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPP--P 646 Query: 680 PXPP----PPGPPXXPPXXPPXXPXP 745 PP PP P PP P P P Sbjct: 647 TNPPQKYIPPVVPTSPP-TPKYLPPP 671 Score = 33.1 bits (72), Expect = 0.59 Identities = 22/81 (27%), Positives = 23/81 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP PPP P PP P PP P + P P PP Sbjct: 615 PPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYI----PPVVPTSPPTPKYLPP 670 Query: 683 XPPPPGPPXXPPXXPPXXPXP 745 G P P P P Sbjct: 671 PQVKQGYDYPKPVIPFPPPAP 691 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PPP P P P PPP P PP P PP Sbjct: 168 PPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPP 211 Score = 32.3 bits (70), Expect = 1.0 Identities = 32/135 (23%), Positives = 33/135 (24%), Gaps = 2/135 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPX-PXPXPPXPPXPX-PXXXXXXXPPSPP 651 P PP P P P + P P P P P PP P PP PP Sbjct: 560 PVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPP 619 Query: 652 RPXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPP 831 P P P PP PPP Sbjct: 620 ----PTSKYLPPPQVKQGYDYPKPAIPFP-PPTNPPQKYIPPVVPTSPPTPKYLPPPQVK 674 Query: 832 XPXXPPPPXPPXPPP 876 P P P PPP Sbjct: 675 QGYDYPKPVIPFPPP 689 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P PPP P P P P P P PP Sbjct: 41 PKPAIPFPPPLPKVVESSGYSYPKPVVPFPPAQPKYTPP 79 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 60.1 bits (139), Expect = 4e-09 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG---XGGAG 547 GG GGPGGG GG G G GGG GG G G G GG G G G GG G Sbjct: 50 GGGFGGPGGG-FGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFG 108 Query: 546 XGGGXXPXXGGAXXGG 499 GG GG GG Sbjct: 109 GPGGGFGGPGGGFGGG 124 Score = 59.7 bits (138), Expect = 6e-09 Identities = 35/79 (44%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGG--GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG GG GG GG GG GG G G GGG GG G G GG G G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGF---GGGGFGGRPGGGFG 108 Query: 570 XXGXGGAGXGGGXXPXXGG 514 G G G GGG GG Sbjct: 109 GPGGGFGGPGGGFGGGFGG 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G GG G GGG GG GGG G GGG GG Sbjct: 71 GGGFGGPGGGFGGQGGGFGGQGGFG----GGGFGGRPGGGFGGPGGGFGG 116 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGG 816 G G G GG G GG G R GGG GG GGG G G G GGG Sbjct: 76 GPGGGFGGQG-GGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGGG 124 Score = 38.7 bits (86), Expect = 0.012 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 1/95 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGG-GXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GG GGG G G G G GG G G G Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGG------------------FGGQ 91 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGG 676 G G G G G G GG GGPGGG GG Sbjct: 92 GGFGGGGFGGRPGGGFGG--PGGGFGGPGGGFGGG 124 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G G G GG G + G G GG GG GG G GGG G Sbjct: 64 GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFG 115 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG--GXGGXGGGGXXGXGGGGG 816 G G G G G GG G + GG G GG GGGG G GGG Sbjct: 57 GGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF-GGRPGGG 106 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG 825 G G G GG G G G GGG GG GGG G GG Sbjct: 83 GQGGGFGGQGGFGGGGFGGRPGGGFGGP-GGGFGGPGGGFGGGFGG 127 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 60.1 bits (139), Expect = 4e-09 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG---XGGAG 547 GG GGPGGG GG G G GGG GG G G G GG G G G GG G Sbjct: 50 GGGFGGPGGG-FGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFG 108 Query: 546 XGGGXXPXXGGAXXGG 499 GG GG GG Sbjct: 109 GPGGGFGGPGGGFGGG 124 Score = 59.7 bits (138), Expect = 6e-09 Identities = 35/79 (44%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGG--GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG GG GG GG GG GG G G GGG GG G G GG G G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGF---GGGGFGGRPGGGFG 108 Query: 570 XXGXGGAGXGGGXXPXXGG 514 G G G GGG GG Sbjct: 109 GPGGGFGGPGGGFGGGFGG 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G GG G GGG GG GGG G GGG GG Sbjct: 71 GGGFGGPGGGFGGQGGGFGGQGGFG----GGGFGGRPGGGFGGPGGGFGG 116 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGG 816 G G G GG G GG G R GGG GG GGG G G G GGG Sbjct: 76 GPGGGFGGQG-GGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGGG 124 Score = 38.7 bits (86), Expect = 0.012 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 1/95 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGG-GXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GG GGG G G G G GG G G G Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGG------------------FGGQ 91 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGG 676 G G G G G G GG GGPGGG GG Sbjct: 92 GGFGGGGFGGRPGGGFGG--PGGGFGGPGGGFGGG 124 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G G G GG G + G G GG GG GG G GGG G Sbjct: 64 GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFG 115 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG--GXGGXGGGGXXGXGGGGG 816 G G G G G GG G + GG G GG GGGG G GGG Sbjct: 57 GGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF-GGRPGGG 106 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG 825 G G G GG G G G GGG GG GGG G GG Sbjct: 83 GQGGGFGGQGGFGGGGFGGRPGGGFGGP-GGGFGGPGGGFGGGFGG 127 >AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-PA protein. Length = 250 Score = 60.1 bits (139), Expect = 4e-09 Identities = 45/141 (31%), Positives = 45/141 (31%), Gaps = 4/141 (2%) Frame = -3 Query: 912 GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGX 733 GG G G G GG G G GG G G G G Sbjct: 67 GGLRGGAGGGYLPGGGRGGGGGGFGGRPAIGAGLVSHVSQSQGNTKVHIGG-GSAGGAGA 125 Query: 732 XGGXXGGXXGGPGG--GGXGGXXXGXGXA--GGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 GG GG G GG G G G A GGG G G G G GG G G Sbjct: 126 YGGGAASYGGGAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGGAGGAGGWQG 185 Query: 564 GXGGAGXGGGXXPXXGGAXXG 502 G G GG GGA G Sbjct: 186 AGAGRGGAGGWQGGAGGAGAG 206 Score = 51.2 bits (117), Expect = 2e-06 Identities = 42/151 (27%), Positives = 43/151 (28%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXX 772 G G GG GG G G GA GG G GG Sbjct: 116 GGGSAGGAGAYGGGAASYGGGAGAAYGGGAGASYGGGAA--------------------- 154 Query: 771 GAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 + G G G G G G G GG G G G AGG GG G G Sbjct: 155 -SYGGGRGSGGWQGAGAGAGRGGAGGAGGWQGAGAGRGGAGGWQGGAGGAGAGNAWGNPA 213 Query: 591 XXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GG GG Sbjct: 214 EFDYTVNHASGGAGGAGGAYGGAAGGGSRGG 244 Score = 44.4 bits (100), Expect = 2e-04 Identities = 37/140 (26%), Positives = 37/140 (26%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G G GG G GG G GGG G G GGG Sbjct: 80 GGGRGGGGGGFGGRPAIGAGLVSHVSQSQGNTKVHIGGGSAGGAGAYGGG---------A 130 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 GG G G GRGG GG G G Sbjct: 131 ASYGGGAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGGAGGAGGWQGAGAGR 190 Query: 602 GGXGGXGXGXGXGGXXGRGG 543 GG GG G G G G Sbjct: 191 GGAGGWQGGAGGAGAGNAWG 210 Score = 37.9 bits (84), Expect = 0.021 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 GG GG GG G G GGG G G G G GG GG Sbjct: 67 GGLRGGAGGGYLPGGGRGGGGGGFGGRPAIGAGLVSHVSQSQGNTKVHIGGGSAGGAGAY 126 Query: 525 XXGGAXXGG 499 G A GG Sbjct: 127 GGGAASYGG 135 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 60.1 bits (139), Expect = 4e-09 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG---XGGAG 547 GG GGPGGG GG G G GGG GG G G G GG G G G GG G Sbjct: 50 GGGFGGPGGG-FGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFG 108 Query: 546 XGGGXXPXXGGAXXGG 499 GG GG GG Sbjct: 109 GPGGGFGGPGGGFGGG 124 Score = 59.7 bits (138), Expect = 6e-09 Identities = 35/79 (44%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGG--GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG GG GG GG GG GG G G GGG GG G G GG G G Sbjct: 52 GFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGF---GGGGFGGRPGGGFG 108 Query: 570 XXGXGGAGXGGGXXPXXGG 514 G G G GGG GG Sbjct: 109 GPGGGFGGPGGGFGGGFGG 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G GG G GGG GG GGG G GGG GG Sbjct: 71 GGGFGGPGGGFGGQGGGFGGQGGFG----GGGFGGRPGGGFGGPGGGFGG 116 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGG 816 G G G GG G GG G R GGG GG GGG G G G GGG Sbjct: 76 GPGGGFGGQG-GGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGGGFGGG 124 Score = 38.7 bits (86), Expect = 0.012 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 1/95 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGG-GXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GG GGG G G G G GG G G G Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGG------------------FGGQ 91 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGG 676 G G G G G G GG GGPGGG GG Sbjct: 92 GGFGGGGFGGRPGGGFGG--PGGGFGGPGGGFGGG 124 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G G G GG G + G G GG GG GG G GGG G Sbjct: 64 GGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFG 115 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG--GXGGXGGGGXXGXGGGGG 816 G G G G G GG G + GG G GG GGGG G GGG Sbjct: 57 GGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGF-GGRPGGG 106 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG 825 G G G GG G G G GGG GG GGG G GG Sbjct: 83 GQGGGFGGQGGFGGGGFGGRPGGGFGGP-GGGFGGPGGGFGGGFGG 127 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 59.7 bits (138), Expect = 6e-09 Identities = 30/70 (42%), Positives = 30/70 (42%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG GGGG GG GGG GG G G GG G G Sbjct: 22 GGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHG 81 Query: 564 GXGGAGXGGG 535 G GG G GGG Sbjct: 82 GGGGGGGGGG 91 Score = 59.3 bits (137), Expect = 8e-09 Identities = 31/69 (44%), Positives = 31/69 (44%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 GG GGGG GG G GGG GG G G G GG G G G G G GGG Sbjct: 23 GGGGGGGQGGWQKNGG--GGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKH 80 Query: 525 XXGGAXXGG 499 GG GG Sbjct: 81 GGGGGGGGG 89 Score = 51.6 bits (118), Expect = 2e-06 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 7/75 (9%) Frame = -3 Query: 717 GGXXGG-------PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 GG GG GGGG GG G GGG GG G G G G G G Sbjct: 23 GGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGG 82 Query: 558 GGAGXGGGXXPXXGG 514 GG G GGG GG Sbjct: 83 GGGGGGGGGKHGGGG 97 Score = 51.2 bits (117), Expect = 2e-06 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 2/78 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGG--PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G GG GG GG GGGG GG G G GGG G G G GG Sbjct: 27 GGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGG-------KHGGGNGGGGK 79 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG GGG Sbjct: 80 HGGGGGGGGGGGKHGGGG 97 Score = 50.4 bits (115), Expect = 4e-06 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGX--GXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG GGG G G G G G GG GG G G G Sbjct: 38 GGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHG 94 Score = 48.8 bits (111), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG GG GGGG GGG G G GG GG GGG G G Sbjct: 51 GGGGGGGGKHGGGGGGGGK-HGGGNGGGGKHGGGGGGGGGGGKHGGGG 97 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G GG GG GGGG G G G GG G G GG Sbjct: 38 GGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGG 76 Score = 43.2 bits (97), Expect = 5e-04 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG G GGG GGG G G GG G GG G G G Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGG 91 Score = 43.2 bits (97), Expect = 5e-04 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGX--GXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G + GGG GG G G G GGGGGG Sbjct: 40 GGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGG 91 Score = 42.3 bits (95), Expect = 0.001 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGG--GXGGXGGGGXXGXGGGGGG 813 G GG G GG G GG GG GGGG G GGGGGG Sbjct: 21 GGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGG 68 Score = 42.3 bits (95), Expect = 0.001 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG 825 G G G G G GG G + GGG GG GGGG G GG Sbjct: 52 GGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGGG 97 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GG GG G GG GG G G GG GGG G G GG Sbjct: 32 GWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGG 87 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGG--XGGGGXXGXGGGGGG 813 G G G GG G G GGG G GGGG G GGGGGG Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGG 88 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG----GXGGGGXXGXGGGGGG 813 G G G GG G G GGG G G GGGG G G GGGG Sbjct: 25 GGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGG 78 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXG 513 G +GG GG G G GG G G G G G GGGG G G Sbjct: 46 GGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -1 Query: 962 GAGXGAGGXGX-----GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GGG G GGGG GGG GG Sbjct: 22 GGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGG 76 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G G G GGG G GGGG G G GGG Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG GG G GG GG GGGG G GGGG Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGGGNGG---GGKHGGGGGGGGGGGKHGGGG 97 Score = 35.1 bits (77), Expect = 0.15 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -3 Query: 654 AGGGXGG----XXXXXXGXGXGXGGXXGXGXXXXGXGGA--GXGGGXXPXXGGAXXGG 499 AGGG GG G G G GG G G GG G GGG GG GG Sbjct: 20 AGGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGG 77 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 654 AGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 + GG GG G GG G G GG G GGG GG Sbjct: 19 SAGGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGG 65 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 501 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 560 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 561 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 615 Query: 944 PRPXPP 961 RP PP Sbjct: 616 TRPGPP 621 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 496 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 551 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 552 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 599 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 502 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 560 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 561 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 605 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 540 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 596 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 597 PGPTRPGPPGPTRPGPPGPTRP 618 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 505 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 564 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 565 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 613 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 545 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 604 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 605 PGPTRPGPPGPTRPGPPGPSPNDP 628 Score = 44.4 bits (100), Expect = 2e-04 Identities = 40/144 (27%), Positives = 40/144 (27%), Gaps = 5/144 (3%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 G GG G G G G GG G G G G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGG 317 Query: 735 XXGGXX----GGXXG-GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G G G G G G G GGG G G G G G G Sbjct: 318 GASGKPVYKDGDRTGLGDGSGNGSGDRISTGN-GGGAGAGDRYISGNGGGVGA--GDRYV 374 Query: 570 XXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G GGA G Sbjct: 375 TGNGGGVGAGDRYTTGNGGAAGSG 398 Score = 44.0 bits (99), Expect = 3e-04 Identities = 44/163 (26%), Positives = 44/163 (26%), Gaps = 15/163 (9%) Frame = -3 Query: 945 GGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGA 766 GG GG GGG G G G GG G GG Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 765 XGX--------GXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G G G G G G G GGG G GGG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 612 XGXGXGGXXGXGXXXXGXGG------AGXGGGXXPXXGGAXXG 502 G G G G G AG GG GGA G Sbjct: 377 NGGGVGAGDRYTTGNGGAAGSGDRYTAGNGGRYNTGNGGAVGG 419 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 565 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 624 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 625 PNDPRYSDKETPGYLPPNQP 644 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 501 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 557 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 558 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 599 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 GP GG G G G GG GG G GG G G G GG P Sbjct: 254 GPNGGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPV 313 Query: 522 XGGAXXGG 499 G G Sbjct: 314 GAGGGASG 321 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 577 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 633 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 634 ETPGYLPPNQPAKGP 648 Score = 34.3 bits (75), Expect = 0.25 Identities = 36/137 (26%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXG-----GPGXGXGXXXXX 708 GG GG GG G G GG GG G G GP G G Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 707 XXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRG------ 546 G G G G G G G G GG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 545 -GGGXGXXXXXGXXXGG 498 GGG G GG Sbjct: 377 NGGGVGAGDRYTTGNGG 393 Score = 31.1 bits (67), Expect = 2.4 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 1/125 (0%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXX 693 G GG GG G G GGG GG GPG G Sbjct: 254 GPNGGNGGNGGSGSGGGFGG----------NGGFGGVGGFGPNGPGGPNG--PKGPKGPP 301 Query: 692 XXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGG-GXGXXXXX 516 G G G GG G G G G G G G GGG G G Sbjct: 302 GPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYIS 361 Query: 515 GXXXG 501 G G Sbjct: 362 GNGGG 366 Score = 29.9 bits (64), Expect = 5.5 Identities = 36/148 (24%), Positives = 36/148 (24%), Gaps = 7/148 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG G G G G G G G G G Sbjct: 284 GPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGD 343 Query: 780 XXXGAXGXGXXXGX----GXXGGXXGG--XXGGPGGGGXGGXXXGXGXAG-GGXGGXXXX 622 G G G G GG G G GGG G G G G G Sbjct: 344 RISTGNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGGAAGSGDRYTA 403 Query: 621 XXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 G G G G G A G Sbjct: 404 GNGGRYNTGNGGAVGGDRTGTGAASGFG 431 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 177 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 231 Query: 944 PRPXPP 961 RP PP Sbjct: 232 TRPGPP 237 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 112 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 167 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 168 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 176 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 177 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 156 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 212 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 213 PGPTRPGPPGPTRPGPPGPTRP 234 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 121 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 180 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 229 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 221 PGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 240 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 241 PNDPRYSDKETPGYLPPNQP 260 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 173 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 174 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 193 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 249 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 250 ETPGYLPPNQPAKGP 264 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 531 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 590 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 591 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 645 Query: 944 PRPXPP 961 RP PP Sbjct: 646 TRPGPP 651 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 526 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 581 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 582 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 532 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 590 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 591 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 570 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 626 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 627 PGPTRPGPPGPTRPGPPGPTRP 648 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 535 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 594 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 595 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 643 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 575 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 634 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 635 PGPTRPGPPGPTRPGPPGPSPNDP 658 Score = 44.4 bits (100), Expect = 2e-04 Identities = 40/144 (27%), Positives = 40/144 (27%), Gaps = 5/144 (3%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 G GG G G G G GG G G G G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGG 317 Query: 735 XXGGXX----GGXXG-GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G G G G G G G GGG G G G G G G Sbjct: 318 GASGKPVYKDGDRTGLGDGSGNGSGDRISTGN-GGGAGAGDRYISGNGGGVGA--GDRYV 374 Query: 570 XXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G GGA G Sbjct: 375 TGNGGGVGAGDRYTTGNGGAAGSG 398 Score = 44.0 bits (99), Expect = 3e-04 Identities = 44/163 (26%), Positives = 44/163 (26%), Gaps = 15/163 (9%) Frame = -3 Query: 945 GGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGA 766 GG GG GGG G G G GG G GG Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 765 XGX--------GXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G G G G G G G GGG G GGG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 612 XGXGXGGXXGXGXXXXGXGG------AGXGGGXXPXXGGAXXG 502 G G G G G AG GG GGA G Sbjct: 377 NGGGVGAGDRYTTGNGGAAGSGDRYTAGNGGRYNTGNGGAVGG 419 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 595 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 654 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 655 PNDPRYSDKETPGYLPPNQP 674 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 531 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 587 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 588 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 GP GG G G G GG GG G GG G G G GG P Sbjct: 254 GPNGGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPV 313 Query: 522 XGGAXXGG 499 G G Sbjct: 314 GAGGGASG 321 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 607 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 663 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 664 ETPGYLPPNQPAKGP 678 Score = 34.3 bits (75), Expect = 0.25 Identities = 36/137 (26%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXG-----GPGXGXGXXXXX 708 GG GG GG G G GG GG G G GP G G Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 707 XXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRG------ 546 G G G G G G G G GG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 545 -GGGXGXXXXXGXXXGG 498 GGG G GG Sbjct: 377 NGGGVGAGDRYTTGNGG 393 Score = 31.1 bits (67), Expect = 2.4 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 1/125 (0%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXX 693 G GG GG G G GGG GG GPG G Sbjct: 254 GPNGGNGGNGGSGSGGGFGG----------NGGFGGVGGFGPNGPGGPNG--PKGPKGPP 301 Query: 692 XXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGG-GXGXXXXX 516 G G G GG G G G G G G G GGG G G Sbjct: 302 GPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYIS 361 Query: 515 GXXXG 501 G G Sbjct: 362 GNGGG 366 Score = 29.9 bits (64), Expect = 5.5 Identities = 36/148 (24%), Positives = 36/148 (24%), Gaps = 7/148 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG G G G G G G G G G Sbjct: 284 GPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGD 343 Query: 780 XXXGAXGXGXXXGX----GXXGGXXGG--XXGGPGGGGXGGXXXGXGXAG-GGXGGXXXX 622 G G G G GG G G GGG G G G G G Sbjct: 344 RISTGNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGGAAGSGDRYTA 403 Query: 621 XXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 G G G G G A G Sbjct: 404 GNGGRYNTGNGGAVGGDRTGTGAASGFG 431 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 531 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 590 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 591 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 645 Query: 944 PRPXPP 961 RP PP Sbjct: 646 TRPGPP 651 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 526 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 581 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 582 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 532 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 590 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 591 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 570 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 626 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 627 PGPTRPGPPGPTRPGPPGPTRP 648 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 535 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 594 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 595 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 643 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 575 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 634 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 635 PGPTRPGPPGPTRPGPPGPSPNDP 658 Score = 44.4 bits (100), Expect = 2e-04 Identities = 40/144 (27%), Positives = 40/144 (27%), Gaps = 5/144 (3%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 G GG G G G G GG G G G G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGG 317 Query: 735 XXGGXX----GGXXG-GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G G G G G G G GGG G G G G G G Sbjct: 318 GASGKPVYKDGDRTGLGDGSGNGSGDRISTGN-GGGAGAGDRYISGNGGGVGA--GDRYV 374 Query: 570 XXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G GGA G Sbjct: 375 TGNGGGVGAGDRYTTGNGGAAGSG 398 Score = 44.0 bits (99), Expect = 3e-04 Identities = 44/163 (26%), Positives = 44/163 (26%), Gaps = 15/163 (9%) Frame = -3 Query: 945 GGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGA 766 GG GG GGG G G G GG G GG Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 765 XGX--------GXXXGXGXXGGXXGGXXGGPG-GGGXGGXXXGXGXAGGGXGGXXXXXXG 613 G G G G G G G GGG G GGG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 612 XGXGXGGXXGXGXXXXGXGG------AGXGGGXXPXXGGAXXG 502 G G G G G AG GG GGA G Sbjct: 377 NGGGVGAGDRYTTGNGGAAGSGDRYTAGNGGRYNTGNGGAVGG 419 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 595 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 654 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 655 PNDPRYSDKETPGYLPPNQP 674 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 531 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 587 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 588 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 GP GG G G G GG GG G GG G G G GG P Sbjct: 254 GPNGGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPV 313 Query: 522 XGGAXXGG 499 G G Sbjct: 314 GAGGGASG 321 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 607 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 663 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 664 ETPGYLPPNQPAKGP 678 Score = 34.3 bits (75), Expect = 0.25 Identities = 36/137 (26%), Positives = 36/137 (26%), Gaps = 12/137 (8%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXG-----GPGXGXGXXXXX 708 GG GG GG G G GG GG G G GP G G Sbjct: 257 GGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAG 316 Query: 707 XXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRG------ 546 G G G G G G G G GG G G Sbjct: 317 GGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYISGNGGGVGAGDRYVTG 376 Query: 545 -GGGXGXXXXXGXXXGG 498 GGG G GG Sbjct: 377 NGGGVGAGDRYTTGNGG 393 Score = 31.1 bits (67), Expect = 2.4 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 1/125 (0%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXX 693 G GG GG G G GGG GG GPG G Sbjct: 254 GPNGGNGGNGGSGSGGGFGG----------NGGFGGVGGFGPNGPGGPNG--PKGPKGPP 301 Query: 692 XXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGG-GXGXXXXX 516 G G G GG G G G G G G G GGG G G Sbjct: 302 GPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGDRISTGNGGGAGAGDRYIS 361 Query: 515 GXXXG 501 G G Sbjct: 362 GNGGG 366 Score = 29.9 bits (64), Expect = 5.5 Identities = 36/148 (24%), Positives = 36/148 (24%), Gaps = 7/148 (4%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG G G G G G G G G G Sbjct: 284 GPNGPGGPNGPKGPKGPPGPPGPPGGLGPVGAGGGASGKPVYKDGDRTGLGDGSGNGSGD 343 Query: 780 XXXGAXGXGXXXGX----GXXGGXXGG--XXGGPGGGGXGGXXXGXGXAG-GGXGGXXXX 622 G G G G GG G G GGG G G G G G Sbjct: 344 RISTGNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGGAAGSGDRYTA 403 Query: 621 XXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 G G G G G A G Sbjct: 404 GNGGRYNTGNGGAVGGDRTGTGAASGFG 431 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 177 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 231 Query: 944 PRPXPP 961 RP PP Sbjct: 232 TRPGPP 237 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 112 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 167 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 168 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 176 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 177 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 156 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 212 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 213 PGPTRPGPPGPTRPGPPGPTRP 234 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 121 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 180 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 229 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 221 PGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 240 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 241 PNDPRYSDKETPGYLPPNQP 260 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 173 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 174 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 193 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 249 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 250 ETPGYLPPNQPAKGP 264 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 59.3 bits (137), Expect = 8e-09 Identities = 37/126 (29%), Positives = 37/126 (29%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP P P P P P GP P PP P P P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P P PP P P P P P PP P Sbjct: 177 TRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPT-RPGPPGPTRP----GPPGP 231 Query: 944 PRPXPP 961 RP PP Sbjct: 232 TRPGPP 237 Score = 54.8 bits (126), Expect = 2e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXX 628 GG P P P PP P PP P P P P P P Sbjct: 112 GGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGPFGPPGP 167 Query: 629 XXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXXP--PXXPXPXXXPXP 763 PP PP P P P P P P GP P P P P P P P Sbjct: 168 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 54.0 bits (124), Expect = 3e-07 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXX 625 GG P P P PP P P P P P PP P P P Sbjct: 118 GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP 176 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P PPGPP PP P P P Sbjct: 177 TRPGPYGPPGPPGP-TGPTRPGPPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 53.2 bits (122), Expect = 5e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXP 679 P P PP P PP P P P PP P PP PP P P P P Sbjct: 156 PTKPGPFGPPGPPGPPGPPGPTR--PGPYGPPGPPGPTGPTRPGPPGPPGPTRPGP-PGP 212 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P PGPP PP P Sbjct: 213 PGPTRPGPPGPTRPGPPGPTRP 234 Score = 51.6 bits (118), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +2 Query: 449 GGLXXPXXXXXXXXXXXPPXXAPPXXGXXPPPXPAPPXPXXXXPX-PXXPPXPXPXPXXX 625 GG P PP P PP P P P P PP P Sbjct: 121 GGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPG 180 Query: 626 XXXPPXPP----PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P PP P PGPP P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPG-PPGPTRPGPPGPPGPTRPGPPGPTRPGPP 229 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXP--XXXXPXPXXPPXPXP--XPXXXXXXPPXPP-PAXPXP 667 P P G PP P P P P P P P P P PP PP P P P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 668 ----XXXPPXPPPPGPPXXPPXXP 727 PP P PGPP P P Sbjct: 221 PGPTRPGPPGPTRPGPPGPSPNDP 244 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 1/80 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P G P P PP P P P PP P P P P P P Sbjct: 181 PYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPPGPS 240 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P PP P Sbjct: 241 PNDPRYSDKETPGYLPPNQP 260 Score = 39.1 bits (87), Expect = 0.009 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 1/102 (0%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXXXX 722 P P P P P P PP PP P PP PP P P Sbjct: 117 PGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPPGPPGPKGP--TKPGPFGPPGPPGPPGP 173 Query: 723 XXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXP-PPXPPXP 845 P P PP P P PP PP P Sbjct: 174 PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPPPAXP----- 661 P PP G P P PP P P P P P P P PP P P P Sbjct: 193 PTRPGPP--GPPGPTRPGPPGPPGPTRPGPPGPTRPGP-PGPTRPGPPGPSPNDPRYSDK 249 Query: 662 -XPXXXPPXPPPPGP 703 P PP P GP Sbjct: 250 ETPGYLPPNQPAKGP 264 >X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP protein) protein. Length = 386 Score = 58.8 bits (136), Expect = 1e-08 Identities = 44/148 (29%), Positives = 44/148 (29%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GG GGG G G G G G G GG Sbjct: 220 GQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQ 279 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 G G G G GG GG G GG GG G GGG G G G Sbjct: 280 ---GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG-----GGGGGGFGNEYQQSYGGGPQR 331 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G GG GG Sbjct: 332 NSNFGNNRPAPYSQGGGGGGFNKGNQGG 359 Score = 54.4 bits (125), Expect = 2e-07 Identities = 44/134 (32%), Positives = 45/134 (33%), Gaps = 3/134 (2%) Frame = -3 Query: 891 GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGG 712 G G G GG G GG GA G G G G GG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG---GFGNSGGNFGG 256 Query: 711 XXGGPGGGGX--GGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 GG GG GG G GGG GG G G G GG G GG G G Sbjct: 257 GQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGG--GGGGGYGGGNSNGSWGGNGGGGGGG 314 Query: 540 GGXXPXXGGAXXGG 499 GG + GG Sbjct: 315 GGFGNEYQQSYGGG 328 Score = 48.0 bits (109), Expect = 2e-05 Identities = 37/134 (27%), Positives = 38/134 (28%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 +GG GG GG G G GG G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQ 258 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GGG GG G G G G G G G G GG Sbjct: 259 GGGSG---GWNQQGGTGGGPWNNQGGGN-GGWNGGGGGGGYGGGNSNGSWGGNGGGGGGG 314 Query: 588 XGXGXXXXGXGGAG 547 G G G G Sbjct: 315 GGFGNEYQQSYGGG 328 Score = 44.4 bits (100), Expect = 2e-04 Identities = 39/149 (26%), Positives = 39/149 (26%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGG 293 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG G GG G G G Sbjct: 294 GYGGGNSNGSWGGNGG-GGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGF 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GGG GG Sbjct: 353 NKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 42.7 bits (96), Expect = 7e-04 Identities = 44/145 (30%), Positives = 44/145 (30%), Gaps = 4/145 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGG-AGGGGGFGNSGG 252 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G G GG GG Sbjct: 253 NFGGGQGGGSGGWNQQGGTGGG--------PWNNQGGGNGGWNGGGGGGGYGGGNSNGSW 304 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGG 540 G G GG GG G G G GGG Sbjct: 305 G-GNGGGGGGGGGFGNEYQQSYGGG 328 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG G Sbjct: 280 GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNR 339 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGX-GXXXXXGAXGXGGGXGG 548 GGG GG G G G G G G G GG GG Sbjct: 340 PAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GRGG G GG G G GG G GG G G GG Sbjct: 201 GGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGG 256 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 58.8 bits (136), Expect = 1e-08 Identities = 44/148 (29%), Positives = 44/148 (29%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GG GGG G G G G G G GG Sbjct: 220 GQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQ 279 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 G G G G GG GG G GG GG G GGG G G G Sbjct: 280 ---GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG-----GGGGGGFGNEYQQSYGGGPQR 331 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G GG GG Sbjct: 332 NSNFGNNRPAPYSQGGGGGGFNKGNQGG 359 Score = 54.0 bits (124), Expect = 3e-07 Identities = 45/142 (31%), Positives = 46/142 (32%), Gaps = 3/142 (2%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GGGG G G GG G GG G G G G Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWG-----------GRGGGGGFG 248 Query: 735 XXGGXXGGXXGGPGGGGX--GGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 GG GG GG GG GG G GGG GG G G G GG G Sbjct: 249 NSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGG--GGGGGYGGGNSNGSWGG 306 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 GG G GGG + GG Sbjct: 307 NGGGGGGGGGFGNEYQQSYGGG 328 Score = 48.0 bits (109), Expect = 2e-05 Identities = 37/134 (27%), Positives = 38/134 (28%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 +GG GG GG G G GG G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQ 258 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GGG GG G G G G G G G G GG Sbjct: 259 GGGSG---GWNQQGGTGGGPWNNQGGGN-GGWNGGGGGGGYGGGNSNGSWGGNGGGGGGG 314 Query: 588 XGXGXXXXGXGGAG 547 G G G G Sbjct: 315 GGFGNEYQQSYGGG 328 Score = 47.6 bits (108), Expect = 3e-05 Identities = 36/126 (28%), Positives = 36/126 (28%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXX 696 GGG GG GG G G G G G GG G G Sbjct: 202 GGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGG 261 Query: 695 XXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXX 516 G G GG G G GG GG GG G GGGG G Sbjct: 262 SGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEY 321 Query: 515 GXXXGG 498 GG Sbjct: 322 QQSYGG 327 Score = 44.4 bits (100), Expect = 2e-04 Identities = 39/149 (26%), Positives = 39/149 (26%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGRGGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGG 293 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG G GG G G G Sbjct: 294 GYGGGNSNGSWGGNGG-GGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGF 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GGG GG Sbjct: 353 NKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 42.3 bits (95), Expect = 0.001 Identities = 44/145 (30%), Positives = 44/145 (30%), Gaps = 4/145 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGGR-GGGGGFGNSGG 252 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G G GG GG Sbjct: 253 NFGGGQGGGSGGWNQQGGTGGG--------PWNNQGGGNGGWNGGGGGGGYGGGNSNGSW 304 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGG 540 G G GG GG G G G GGG Sbjct: 305 G-GNGGGGGGGGGFGNEYQQSYGGG 328 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG G Sbjct: 280 GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNR 339 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGX-GXXXXXGAXGXGGGXGG 548 GGG GG G G G G G G G GG GG Sbjct: 340 PAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 31.1 bits (67), Expect = 2.4 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 8/60 (13%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXG--------XGXGGXXGRGGGGXGXXXXXGXXXGG 498 +GG GG G G G G G G G G GRGGGG G G GG Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGG-GFGNSGGNFGGG 257 >X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. Length = 386 Score = 58.8 bits (136), Expect = 1e-08 Identities = 44/148 (29%), Positives = 44/148 (29%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GG GGG G G G G G G GG Sbjct: 220 GQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQ 279 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 G G G G GG GG G GG GG G GGG G G G Sbjct: 280 ---GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG-----GGGGGGFGNEYQQSYGGGPQR 331 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G GG GG Sbjct: 332 NSNFGNNRPAPYSQGGGGGGFNKGNQGG 359 Score = 54.4 bits (125), Expect = 2e-07 Identities = 44/134 (32%), Positives = 45/134 (33%), Gaps = 3/134 (2%) Frame = -3 Query: 891 GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGG 712 G G G GG G GG GA G G G G GG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG---GFGNSGGNFGG 256 Query: 711 XXGGPGGGGX--GGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 GG GG GG G GGG GG G G G GG G GG G G Sbjct: 257 GQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGG--GGGGGYGGGNSNGSWGGNGGGGGGG 314 Query: 540 GGXXPXXGGAXXGG 499 GG + GG Sbjct: 315 GGFGNEYQQSYGGG 328 Score = 48.0 bits (109), Expect = 2e-05 Identities = 37/134 (27%), Positives = 38/134 (28%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 +GG GG GG G G GG G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQ 258 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GGG GG G G G G G G G G GG Sbjct: 259 GGGSG---GWNQQGGSGGGPWNNQGGGN-GGWNGGGGGGGYGGGNSNGSWGGNGGGGGGG 314 Query: 588 XGXGXXXXGXGGAG 547 G G G G Sbjct: 315 GGFGNEYQQSYGGG 328 Score = 45.2 bits (102), Expect = 1e-04 Identities = 39/149 (26%), Positives = 39/149 (26%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG 293 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG G GG G G G Sbjct: 294 GYGGGNSNGSWGGNGG-GGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGF 352 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GGG GG Sbjct: 353 NKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 42.7 bits (96), Expect = 7e-04 Identities = 44/145 (30%), Positives = 44/145 (30%), Gaps = 4/145 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGG-AGGGGGFGNSGG 252 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G G GG GG Sbjct: 253 NFGGGQGGGSGGWNQQGGSGGG--------PWNNQGGGNGGWNGGGGGGGYGGGNSNGSW 304 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGG 540 G G GG GG G G G GGG Sbjct: 305 G-GNGGGGGGGGGFGNEYQQSYGGG 328 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG G Sbjct: 280 GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNR 339 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGX-GXXXXXGAXGXGGGXGG 548 GGG GG G G G G G G G GG GG Sbjct: 340 PAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGG 381 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GRGG G GG G G GG G GG G G GG Sbjct: 201 GGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGG 256 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 58.8 bits (136), Expect = 1e-08 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P PP P P PP PPP PP PPPPG PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 728 PXXPXPXXXPXP 763 P P P P Sbjct: 572 PGMMRPGGGPPP 583 Score = 58.0 bits (134), Expect = 2e-08 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP G PP P PP P P PP P P P PP PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP-PPPMPGRAGGPPPPPPPPG---MGGPP 567 Query: 683 XPPPPG--PPXXPPXXPPXXPXPXXXPXP 763 PP PG P P PP P P Sbjct: 568 PPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP------XXPPXPXPXPXPPXPPXPXPXXXXXXXP 639 P PP P PPPP P PP P P P P P P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGP 566 Query: 640 PSPPRP 657 P PP P Sbjct: 567 PPPPMP 572 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXP------PXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P P P P P P PP P P PP PP P Sbjct: 503 PNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P PP P P PPPP PP PP P Sbjct: 539 PPPPPP--PPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP-------XPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP PP PPP P PP P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP---XXXPPXPPPPXXP 665 PS P P PPP P PPP PP P PP PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGG----GGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX--PPXXPPXXPXPXXXPXP 763 P P P PP PP P PP PP PG PP PP P P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP 556 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P P P PP P PP PP P PP PP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRP 952 PP P P P P P PPP P PP PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P PPPP PP P PP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP PP PPP P P PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP P P PPP P PP P P P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 34.3 bits (75), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 PPPPPP P PP PP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPA---PPPPXXXP-------PXPPPP 656 P PP PP AP P P A PPPP P P PPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP-----XPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P P P PPPP PP P PP Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 33.5 bits (73), Expect = 0.44 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 6/109 (5%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXX 823 P P P PPPPG PP PP P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGP------ 554 Query: 824 XXXXXXXPPXPXPXXPPXPAPXPXP------AXPPPPXXXXXPPXPPRP 952 PP P P P P P P PPPP P P P Sbjct: 555 -------PPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P P PP P P PP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 33.5 bits (73), Expect = 0.44 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP P P PPPP PP P PP P P PP PP P Sbjct: 543 PPPPMPGRAGGPPPPPP----PPGMGGPPPPPMPGMMRP----GGGPPPPPMMMGP 590 Score = 33.1 bits (72), Expect = 0.59 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 8/82 (9%) Frame = +1 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX--------PXXPPPPXPPXPPPXXX 885 P P PP PPPPPP P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 886 XXXXXXXXXXXPXPPXPXPPAP 951 P P P P Sbjct: 572 PGMMRPGGGPPPPPMMMGPMVP 593 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 547 PRPXXP---PXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 P+ P P P PP PP P P PP PP P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-PPMPGRAGGPPPPPPPPGMGG 565 Query: 718 XXPXPXPG 741 P P PG Sbjct: 566 PPPPPMPG 573 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP 649 PP PP G P PP P P PP P P PP PP Sbjct: 540 PPPPPPPMPGRAG--GPPPPPPPPGMGGP--PPPPMPGMMRPGGGPPPPP 585 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP----AXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P PPPP P P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX----PPPPXXXXXPPXPPR---PXPP 961 PP P P P P P P PPPP PP P R P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP---PPMPGRAGGPPPP 557 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 58.8 bits (136), Expect = 1e-08 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P PP P P PP PPP PP PPPPG PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 728 PXXPXPXXXPXP 763 P P P P Sbjct: 572 PGMMRPGGGPPP 583 Score = 58.0 bits (134), Expect = 2e-08 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP G PP P PP P P PP P P P PP PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP-PPPMPGRAGGPPPPPPPPG---MGGPP 567 Query: 683 XPPPPG--PPXXPPXXPPXXPXPXXXPXP 763 PP PG P P PP P P Sbjct: 568 PPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP------XXPPXPXPXPXPPXPPXPXPXXXXXXXP 639 P PP P PPPP P PP P P P P P P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGP 566 Query: 640 PSPPRP 657 P PP P Sbjct: 567 PPPPMP 572 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXP------PXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P P P P P P PP P P PP PP P Sbjct: 503 PNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P PP P P PPPP PP PP P Sbjct: 539 PPPPPP--PPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP-------XPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP PP PPP P PP P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP---XXXPPXPPPPXXP 665 PS P P PPP P PPP PP P PP PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGG----GGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX--PPXXPPXXPXPXXXPXP 763 P P P PP PP P PP PP PG PP PP P P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP 556 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P P P PP P PP PP P PP PP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRP 952 PP P P P P P PPP P PP PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P PPPP PP P PP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP PP PPP P P PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP P P PPP P PP P P P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 34.3 bits (75), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 PPPPPP P PP PP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPA---PPPPXXXP-------PXPPPP 656 P PP PP AP P P A PPPP P P PPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP-----XPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P P P PPPP PP P PP Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 33.5 bits (73), Expect = 0.44 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 6/109 (5%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXX 823 P P P PPPPG PP PP P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGP------ 554 Query: 824 XXXXXXXPPXPXPXXPPXPAPXPXP------AXPPPPXXXXXPPXPPRP 952 PP P P P P P P PPPP P P P Sbjct: 555 -------PPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P P PP P P PP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 33.5 bits (73), Expect = 0.44 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP P P PPPP PP P PP P P PP PP P Sbjct: 543 PPPPMPGRAGGPPPPPP----PPGMGGPPPPPMPGMMRP----GGGPPPPPMMMGP 590 Score = 33.1 bits (72), Expect = 0.59 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 8/82 (9%) Frame = +1 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX--------PXXPPPPXPPXPPPXXX 885 P P PP PPPPPP P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 886 XXXXXXXXXXXPXPPXPXPPAP 951 P P P P Sbjct: 572 PGMMRPGGGPPPPPMMMGPMVP 593 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 547 PRPXXP---PXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 P+ P P P PP PP P P PP PP P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-PPMPGRAGGPPPPPPPPGMGG 565 Query: 718 XXPXPXPG 741 P P PG Sbjct: 566 PPPPPMPG 573 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP 649 PP PP G P PP P P PP P P PP PP Sbjct: 540 PPPPPPPMPGRAG--GPPPPPPPPGMGGP--PPPPMPGMMRPGGGPPPPP 585 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP----AXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P PPPP P P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX----PPPPXXXXXPPXPPR---PXPP 961 PP P P P P P P PPPP PP P R P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP---PPMPGRAGGPPPP 557 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 58.8 bits (136), Expect = 1e-08 Identities = 46/153 (30%), Positives = 47/153 (30%), Gaps = 4/153 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXX-GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GG GG GGGG G G G G G GG Sbjct: 206 GGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGW 265 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGG---GXGGXXXGXGXAGGGXGGXXXXXXG 613 G+ G G GG GG GG GGG G G G G GGG G G Sbjct: 266 NQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYG 325 Query: 612 XGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG GG Sbjct: 326 GGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGG 358 Score = 55.6 bits (128), Expect = 1e-07 Identities = 40/131 (30%), Positives = 41/131 (31%) Frame = -3 Query: 891 GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGG 712 G G G GG G GG GA G G G G GG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG---GFGNSGGNFGG 256 Query: 711 XXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGX 532 GG GG G G GG G G G GG G GG G GGG Sbjct: 257 GQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGF 316 Query: 531 XPXXGGAXXGG 499 + GG Sbjct: 317 GNEYQQSYGGG 327 Score = 41.1 bits (92), Expect = 0.002 Identities = 38/149 (25%), Positives = 38/149 (25%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG 293 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G GG GG G GG G G G Sbjct: 294 YGG-GNSNGSWGGNGG-GGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGF 351 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GGG GG Sbjct: 352 NKGNQGGGQGFAGNNYNTGGGGQGGNMGG 380 Score = 40.7 bits (91), Expect = 0.003 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGGAGGGGG------- 246 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G GG GG Sbjct: 247 -------FGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQG-------GGNGG-----WN 287 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG GG G GGGG G GG Sbjct: 288 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 326 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/101 (26%), Positives = 27/101 (26%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G G GG G Sbjct: 280 GGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRP 339 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGGG G GG G G G G GG GG Sbjct: 340 APYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGG 380 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 58.8 bits (136), Expect = 1e-08 Identities = 46/153 (30%), Positives = 47/153 (30%), Gaps = 4/153 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXX-GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GG GG GGGG G G G G G GG Sbjct: 206 GGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGW 265 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGG---GXGGXXXGXGXAGGGXGGXXXXXXG 613 G+ G G GG GG GG GGG G G G G GGG G G Sbjct: 266 NQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYG 325 Query: 612 XGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GG GG Sbjct: 326 GGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGG 358 Score = 55.6 bits (128), Expect = 1e-07 Identities = 40/131 (30%), Positives = 41/131 (31%) Frame = -3 Query: 891 GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGG 712 G G G GG G GG GA G G G G GG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG---GFGNSGGNFGG 256 Query: 711 XXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGX 532 GG GG G G GG G G G GG G GG G GGG Sbjct: 257 GQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGF 316 Query: 531 XPXXGGAXXGG 499 + GG Sbjct: 317 GNEYQQSYGGG 327 Score = 41.1 bits (92), Expect = 0.002 Identities = 38/149 (25%), Positives = 38/149 (25%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG 293 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G GG GG G GG G G G Sbjct: 294 YGG-GNSNGSWGGNGG-GGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGF 351 Query: 600 XGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 G G G G GGG GG Sbjct: 352 NKGNQGGGQGFAGNNYNTGGGGQGGNMGG 380 Score = 40.7 bits (91), Expect = 0.003 Identities = 47/159 (29%), Positives = 47/159 (29%), Gaps = 4/159 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGGAGGGGG------- 246 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G GG GG Sbjct: 247 -------FGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQG-------GGNGG-----WN 287 Query: 614 GXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G G GG GG GG G GGGG G GG Sbjct: 288 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 326 Score = 34.3 bits (75), Expect = 0.25 Identities = 27/101 (26%), Positives = 27/101 (26%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G G GG G Sbjct: 280 GGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRP 339 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGGG G GG G G G G GG GG Sbjct: 340 APYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGG 380 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 58.8 bits (136), Expect = 1e-08 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P PP P P PP PPP PP PPPPG PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 728 PXXPXPXXXPXP 763 P P P P Sbjct: 572 PGMMRPGGGPPP 583 Score = 58.0 bits (134), Expect = 2e-08 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP G PP P PP P P PP P P P PP PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP-PPPMPGRAGGPPPPPPPPG---MGGPP 567 Query: 683 XPPPPG--PPXXPPXXPPXXPXPXXXPXP 763 PP PG P P PP P P Sbjct: 568 PPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP------XXPPXPXPXPXPPXPPXPXPXXXXXXXP 639 P PP P PPPP P PP P P P P P P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGP 566 Query: 640 PSPPRP 657 P PP P Sbjct: 567 PPPPMP 572 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXP------PXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P P P P P P PP P P PP PP P Sbjct: 503 PNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P PP P P PPPP PP PP P Sbjct: 539 PPPPPP--PPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP-------XPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP PP PPP P PP P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP---XXXPPXPPPPXXP 665 PS P P PPP P PPP PP P PP PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGG----GGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX--PPXXPPXXPXPXXXPXP 763 P P P PP PP P PP PP PG PP PP P P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP 556 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P P P PP P PP PP P PP PP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRP 952 PP P P P P P PPP P PP PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P PPPP PP P PP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP PP PPP P P PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP P P PPP P PP P P P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 34.3 bits (75), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 PPPPPP P PP PP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPA---PPPPXXXP-------PXPPPP 656 P PP PP AP P P A PPPP P P PPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP-----XPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P P P PPPP PP P PP Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 33.5 bits (73), Expect = 0.44 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 6/109 (5%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXX 823 P P P PPPPG PP PP P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGP------ 554 Query: 824 XXXXXXXPPXPXPXXPPXPAPXPXP------AXPPPPXXXXXPPXPPRP 952 PP P P P P P P PPPP P P P Sbjct: 555 -------PPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P P PP P P PP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 33.5 bits (73), Expect = 0.44 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP P P PPPP PP P PP P P PP PP P Sbjct: 543 PPPPMPGRAGGPPPPPP----PPGMGGPPPPPMPGMMRP----GGGPPPPPMMMGP 590 Score = 33.1 bits (72), Expect = 0.59 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 8/82 (9%) Frame = +1 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX--------PXXPPPPXPPXPPPXXX 885 P P PP PPPPPP P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 886 XXXXXXXXXXXPXPPXPXPPAP 951 P P P P Sbjct: 572 PGMMRPGGGPPPPPMMMGPMVP 593 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 547 PRPXXP---PXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 P+ P P P PP PP P P PP PP P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-PPMPGRAGGPPPPPPPPGMGG 565 Query: 718 XXPXPXPG 741 P P PG Sbjct: 566 PPPPPMPG 573 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP 649 PP PP G P PP P P PP P P PP PP Sbjct: 540 PPPPPPPMPGRAG--GPPPPPPPPGMGGP--PPPPMPGMMRPGGGPPPPP 585 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP----AXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P PPPP P P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX----PPPPXXXXXPPXPPR---PXPP 961 PP P P P P P P PPPP PP P R P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP---PPMPGRAGGPPPP 557 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 58.8 bits (136), Expect = 1e-08 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P PP P P PP P P PP PPP PP PPPPG PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 728 PXXPXPXXXPXP 763 P P P P Sbjct: 572 PGMMRPGGGPPP 583 Score = 58.0 bits (134), Expect = 2e-08 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP G PP P PP P P PP P P P PP PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP-PPPMPGRAGGPPPPPPPPG---MGGPP 567 Query: 683 XPPPPG--PPXXPPXXPPXXPXPXXXPXP 763 PP PG P P PP P P Sbjct: 568 PPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP------XXPPXPXPXPXPPXPPXPXPXXXXXXXP 639 P PP P PPPP P PP P P P P P P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGP 566 Query: 640 PSPPRP 657 P PP P Sbjct: 567 PPPPMP 572 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXP------PXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P P P P P P PP P P PP PP P Sbjct: 503 PNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P PP P P PPPP PP PP P Sbjct: 539 PPPPPP--PPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP-------XPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP PP PPP P PP P P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPP 568 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP---XXXPPXPPPPXXP 665 PS P P PPP P PPP PP P PP PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGG----GGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX--PPXXPPXXPXPXXXPXP 763 P P P PP PP P PP PP PG PP PP P P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPP--PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPP 556 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P P P PP P PP PP P PP PP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPP-PXXXXXPPXPPRP 952 PP P P P P P PPP P PP PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P PPPP PP P PP Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPPP PP PPP P P PP P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP P P PPP P PP P P P Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 34.3 bits (75), Expect = 0.25 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 PPPPPP P PP PP P Sbjct: 554 PPPPPPPPGMGGPPPPPMP 572 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPA---PPPPXXXP-------PXPPPP 656 P PP PP AP P P A PPPP P P PPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP-----XPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P P P PPPP PP P PP Sbjct: 517 PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP 560 Score = 33.5 bits (73), Expect = 0.44 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 6/109 (5%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXX 823 P P P PPPPG PP PP P P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGP------ 554 Query: 824 XXXXXXXPPXPXPXXPPXPAPXPXP------AXPPPPXXXXXPPXPPRP 952 PP P P P P P P PPPP P P P Sbjct: 555 -------PPPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P P PP P P PP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 33.5 bits (73), Expect = 0.44 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP P P PPPP PP P PP P P PP PP P Sbjct: 543 PPPPMPGRAGGPPPPPP----PPGMGGPPPPPMPGMMRP----GGGPPPPPMMMGP 590 Score = 33.1 bits (72), Expect = 0.59 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 8/82 (9%) Frame = +1 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPX--------PXXPPPPXPPXPPPXXX 885 P P PP PPPPPP P PPPP PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 886 XXXXXXXXXXXPXPPXPXPPAP 951 P P P P Sbjct: 572 PGMMRPGGGPPPPPMMMGPMVP 593 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 547 PRPXXP---PXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 P+ P P P PP PP P P PP PP P P Sbjct: 507 PKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP-PPMPGRAGGPPPPPPPPGMGG 565 Query: 718 XXPXPXPG 741 P P PG Sbjct: 566 PPPPPMPG 573 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP 649 PP PP G P PP P P PP P P PP PP Sbjct: 540 PPPPPPPMPGRAG--GPPPPPPPPGMGGP--PPPPMPGMMRPGGGPPPPP 585 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP----AXPPPPXXXXXPPXPPRPXPP 961 PP P P P P P P PPPP P P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX----PPPPXXXXXPPXPPR---PXPP 961 PP P P P P P P PPPP PP P R P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP---PPMPGRAGGPPPP 557 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 58.4 bits (135), Expect = 1e-08 Identities = 44/145 (30%), Positives = 47/145 (32%), Gaps = 3/145 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG GG Sbjct: 22 GGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAGGS 81 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXG--GXXXGXGXAGG-GXGGXXXXXXGX 610 + G G G G G GG GG GG +GG G GG G Sbjct: 82 GGWQSGGGG---GSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGY 138 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G +G GGG Sbjct: 139 GGASGGGWSSGGASSGGWSSGGGGG 163 Score = 46.4 bits (105), Expect = 6e-05 Identities = 45/156 (28%), Positives = 45/156 (28%), Gaps = 7/156 (4%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXX 765 GG G GG G G GG GGGG GGGGG Sbjct: 20 GGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAG 79 Query: 764 XXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG-----XXXXXXXGXGXG 600 G G G G G G G GG GG G Sbjct: 80 GSGGWQSGGGGGSG---------------WTAGGGGGHGGGGGGQEIKIIKIISQQASSG 124 Query: 599 GXGGXGXGXGXGGXXGRGGGG--XGXXXXXGXXXGG 498 G GG G G GG G GGG G G GG Sbjct: 125 GHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGG 160 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 17/91 (18%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG----GXGG-------------XX 628 G G G GG GG GGGG GG G G GG G GG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETA 76 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GG G GGG Sbjct: 77 PAGGSGGWQSGGGGGSGWTAGGGGGHGGGGG 107 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGA---GGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GGGG+ GGG G G G G G GGG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 649 GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GGGG GGG G G G GG GG G G Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 36.3 bits (80), Expect = 0.063 Identities = 37/137 (27%), Positives = 37/137 (27%), Gaps = 13/137 (9%) Frame = -1 Query: 869 GXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXX 690 G G GGGG G GGGG GG G G Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGG---GGGSPPVKVIKVIH 73 Query: 689 XXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGG-------------XGXGXGXGGXXGR 549 G G GG GG G G GG GG G GG G Sbjct: 74 ETAPAGGSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGG 133 Query: 548 GGGGXGXXXXXGXXXGG 498 GG G G GG Sbjct: 134 SSGGYGGASGGGWSSGG 150 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG-GAGXGGGXXPXXGG 514 G GGG GG G G G GG G G G G GGG GG Sbjct: 17 GFIGGGGGG------GGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGG 60 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 58.4 bits (135), Expect = 1e-08 Identities = 44/145 (30%), Positives = 47/145 (32%), Gaps = 3/145 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG GGGG G G G GG GG Sbjct: 22 GGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAGGS 81 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXG--GXXXGXGXAGG-GXGGXXXXXXGX 610 + G G G G G GG GG GG +GG G GG G Sbjct: 82 GGWQSGGGG---GSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGGSSGGY 138 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G +G GGG Sbjct: 139 GGASGGGWSSGGASSGGWSSGGGGG 163 Score = 46.4 bits (105), Expect = 6e-05 Identities = 45/156 (28%), Positives = 45/156 (28%), Gaps = 7/156 (4%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXX 765 GG G GG G G GG GGGG GGGGG Sbjct: 20 GGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAG 79 Query: 764 XXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGG-----XXXXXXXGXGXG 600 G G G G G G G GG GG G Sbjct: 80 GSGGWQSGGGGGSG---------------WTAGGGGGHGGGGGGQEIKIIKIISQQASSG 124 Query: 599 GXGGXGXGXGXGGXXGRGGGG--XGXXXXXGXXXGG 498 G GG G G GG G GGG G G GG Sbjct: 125 GHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGG 160 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 17/91 (18%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG----GXGG-------------XX 628 G G G GG GG GGGG GG G G GG G GG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETA 76 Query: 627 XXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG G G G GG G GGG Sbjct: 77 PAGGSGGWQSGGGGGSGWTAGGGGGHGGGGG 107 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGA---GGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GGGG+ GGG G G G G G GGG Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 649 GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GGGG GGG G G G GG GG G G Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGG 62 Score = 36.3 bits (80), Expect = 0.063 Identities = 37/137 (27%), Positives = 37/137 (27%), Gaps = 13/137 (9%) Frame = -1 Query: 869 GXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXX 690 G G GGGG G GGGG GG G G Sbjct: 17 GFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGG---GGGSPPVKVIKVIH 73 Query: 689 XXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGG-------------XGXGXGXGGXXGR 549 G G GG GG G G GG GG G GG G Sbjct: 74 ETAPAGGSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYGG 133 Query: 548 GGGGXGXXXXXGXXXGG 498 GG G G GG Sbjct: 134 SSGGYGGASGGGWSSGG 150 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG-GAGXGGGXXPXXGG 514 G GGG GG G G G GG G G G G GGG GG Sbjct: 17 GFIGGGGGG------GGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGG 60 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 57.6 bits (133), Expect = 2e-08 Identities = 31/79 (39%), Positives = 31/79 (39%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGGG G G GGG GG G G G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGL 93 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG G P GG G Sbjct: 94 GGFANGRPIAPGGGGGGGG 112 Score = 54.4 bits (125), Expect = 2e-07 Identities = 34/88 (38%), Positives = 35/88 (39%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG GG GGGG G G G GGG G G G G G G Sbjct: 44 GGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGG-GPGGGGAG-------GFGGGNNGLGG 95 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG P + GG Sbjct: 96 FANGRPIAPGGGGGGGGAPAPRPSPSGG 123 Score = 52.4 bits (120), Expect = 9e-07 Identities = 31/73 (42%), Positives = 31/73 (42%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GPGGG GG G G AGGG GG G G G G G G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGG--------GGGGGPAGGFGGGPGGGGAG 84 Query: 549 GXGGGXXPXXGGA 511 G GGG G A Sbjct: 85 GFGGGNNGLGGFA 97 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GG GG GGGG G GGG G Sbjct: 44 GGGFGGGG-GFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNG 92 Score = 41.9 bits (94), Expect = 0.001 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG GGGGAGGG G GGG GG GG G G G Sbjct: 44 GGGFGGGGGFGGGGAGGGYG----------GGGGGGPAGGFGGGPGGGGAGG 85 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 654 AGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 + GG G G G G GG G G G GG G GG GG GG Sbjct: 31 SAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGG 82 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GG G GGG GGG G G G GGG GG GGG Sbjct: 33 GGSPGAGLQGPGGGFGGGGG----FGGGGAGGGYGGGGGG 68 Score = 38.7 bits (86), Expect = 0.012 Identities = 32/95 (33%), Positives = 32/95 (33%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G G GGGG G G G G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAG---------------GFGGGP 78 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGG 676 GA G G G GG G PGGGG GG Sbjct: 79 GGGGAGGFG--GGNNGLGGFANGRPIAPGGGGGGG 111 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G+ G G G G GGG GG GGGG G GGG G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPG 79 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GAG G G GG G GGG GG GG G GGGG G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYG--GGGGGGPAGGFGGGPGGGGAG 84 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G GGG GG G GG G G GG Sbjct: 46 GFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGG 95 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G G G GGG G GGG G GG G Sbjct: 50 GGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANG 99 Score = 35.9 bits (79), Expect = 0.083 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG GG G G GG G GGGGGG Sbjct: 61 GYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -1 Query: 962 GAGXGAGGXGXGGX-GXXXXXXXXXXXXRXGGGXGGXGGGGXX-----GXGGGGGG 813 GAG G GG G GG G GGG G GG G GGGGGG Sbjct: 57 GAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 112 Score = 35.1 bits (77), Expect = 0.15 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GGG G G G G GGG G GG G G G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 30.3 bits (65), Expect = 4.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 A G G G G G G G GGGG GG GGG Sbjct: 29 AASAGGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGG 77 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 56.8 bits (131), Expect = 4e-08 Identities = 31/70 (44%), Positives = 31/70 (44%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G GG GG G GG G GG G G GGG G G G GG G G Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRG------GAGRNGGGGGGGGGFNR 224 Query: 564 GXGGAGXGGG 535 G GG G GGG Sbjct: 225 GRGGGGGGGG 234 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -3 Query: 696 GGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXG 517 GGGG GG G G GGG GG G G G GG G GG G GGG G Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGR---GGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRG 227 Query: 516 GAXXGG 499 G GG Sbjct: 228 GGGGGG 233 Score = 51.6 bits (118), Expect = 2e-06 Identities = 32/70 (45%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -3 Query: 705 GGPGGGGXGG-XXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXX 529 GG GGGG GG G G GGG GG G G G GG G G G GG G GG Sbjct: 172 GGGGGGGFGGRGGRGGGRGGGGRGG------GGGRGGGGFRG-GAGRNGGGGGGGGGFNR 224 Query: 528 PXXGGAXXGG 499 GG GG Sbjct: 225 GRGGGGGGGG 234 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGGG GG GGGG G G G G G GGG GG GG G G G Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGGG--GGRGGGGGRGGGGGFGRGGGGRGGGRG 57 Score = 48.0 bits (109), Expect = 2e-05 Identities = 29/66 (43%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX----GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G G G G GG GG GG GGGG G G G GGG GG G G G G Sbjct: 175 GGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRG---GAGRNGGGGGGGGGFNRGRGGGGG 231 Query: 594 GXXGXG 577 G G G Sbjct: 232 GGGGRG 237 Score = 47.6 bits (108), Expect = 3e-05 Identities = 28/57 (49%), Positives = 28/57 (49%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G P GGG GG G G GGG GG G G G GG G G G GG G GGG Sbjct: 4 GKPRGGGGGG---GRGFGGGG-GGRGFGGGGGGRGGGGGRGGGGGF-GRGGGGRGGG 55 Score = 46.8 bits (106), Expect = 4e-05 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G R GGG GG GGG G GGGGGG Sbjct: 184 GRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGG-GGGGGGFNRGRGGGGGG 232 Score = 46.4 bits (105), Expect = 6e-05 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GRGG GG G G GG GG G G G G GGGG G G GG Sbjct: 178 GFGGRGGRGGGRGGGGRG-GGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGG 232 Score = 45.6 bits (103), Expect = 1e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G G G GG G G GG GG G G G GG GRGGGG G Sbjct: 10 GGGGGRGFGGGGGGRGFGGGGGGRGGGG-GRGGGGGFGRGGGGRG 53 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G GGG GG Sbjct: 12 GGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 54 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 960 GGXGRG--GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG GRG G GG GGGG G G G G GG G G GG Sbjct: 11 GGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 51 Score = 44.0 bits (99), Expect = 3e-04 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G G GG G G G GG GRGGGG G G GG Sbjct: 7 RGGGGGGGRGFGGGGGGRGFGGGGGGRGGGG--GRGGGG-GFGRGGGGRGGG 55 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG GGGG GG G G G GGG GG G G G G Sbjct: 186 GGGRGGGGRGGGGGRGGGGFRGGAGRNG-GGGGGGGGFNRGRGGGGGGGGG 235 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G GG G GG G GGG GG GG G G G GGG Sbjct: 9 GGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 55 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG----GAGGGXGXXXXXGAXGXGGGXGGXG 542 G GGGG GG GG G GGG G G G GGG GG G Sbjct: 193 GRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGGRG 237 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -2 Query: 646 GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G GGGG G G G G G GGG GG GGG G G G Sbjct: 2 GFGKPRGGGGGGGRGFG--GGGGGRGFGGGGGGRGGGGGRGGGGGFGRG 48 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGG--XGGGGXXGXGGGGGG 813 G G GG G GG G GG GG GG G G GGGGGG Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGG 220 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G GG GG G GGGG G G G GGG G G G GG G Sbjct: 4 GKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 57 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GG GG GGGG GGG G G G GGG G G Sbjct: 22 GGRGFGGGGGGRGGGGGRGGGGG--FGRGGGGRGGGRGAFDTG 62 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G GG GG GGGG G G G GG G G GG Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGG 43 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G GG G GGG G G G GGGGGG Sbjct: 172 GGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGG 221 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G GGG GG G G G G G G G GG G GGG GG G Sbjct: 4 GKPRGGGGGGGRGFGGGGGGRGFG---GGGGGRGGGGGRGGGGGFGRGGGGRGGG 55 Score = 38.3 bits (85), Expect = 0.016 Identities = 30/90 (33%), Positives = 30/90 (33%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 RGG GG G GG G G G GG G G GG Sbjct: 170 RGGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGG------------------------F 205 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXG 679 G G G G GG GG GGGG G Sbjct: 206 RGGAGRNGGGGGGGGGFNRGRGGGGGGGGG 235 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G RGG GG GGGG G G G G GG G G G Sbjct: 4 GKPRGGGGGGGRGFGGGG-GGRGFGGGGGGRGGGGGRG 40 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGX--AGXGXGAGXG-GXXGXGXGG 844 GG G GG GG GGGG G G G G G G G G GG Sbjct: 13 GGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 54 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 GG GRG GG GGGG G G GG G G G Sbjct: 20 GGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 57 Score = 37.1 bits (82), Expect = 0.036 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG G GGG GG G G GGG G G G G Sbjct: 8 GGGGGGGRGFGGG--GGGRGF--GGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 57 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXG 853 GG RGG G GGGG G G G GG G G Sbjct: 202 GGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGGRG 237 Score = 34.3 bits (75), Expect = 0.25 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 960 GGXGRG-GXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G G G GG GG G G G G G GG G G Sbjct: 171 GGGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAG 210 Score = 33.5 bits (73), Expect = 0.44 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G GGG G GGG G GGG G Sbjct: 12 GGGRGFGGGG-GGRGFGGGGGGRGGGGGRGGGGGFGRGGG--GRGGGRG 57 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 G G GGGG G GGGGGG Sbjct: 4 GKPRGGGGGGGRGFGGGGGG 23 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 933 GXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G GGGG G G G G GG G GG Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGRGFGGGGG 31 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 56.4 bits (130), Expect = 5e-08 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGGG GG GGGG GGG G G G GGG GG GG G G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 49.2 bits (112), Expect = 8e-06 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G P GGG GG G G GGG GG G G GG G G GG G GGG Sbjct: 4 GKPRGGGGGG---GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G GG G G G G GG GRGGGG G G GG Sbjct: 7 RGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGG-GFGRGGGGRGGG 57 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 665 GXXGRG-GXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GRG G GG G G GG GG G G G GG GRGGGG G Sbjct: 11 GGGGRGFGGGGGGGGRGFGGGGGGRGGGG-GRGGGGGFGRGGGGRG 55 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG-GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG G GG GGG G GGG G G G GGG G GGG G Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 46.4 bits (105), Expect = 6e-05 Identities = 30/66 (45%), Positives = 30/66 (45%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G G GG G GGGG GG G G GGG GG G G G GG G G Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGR-GFGGGGGGRGG------GGGRGGGGGFGRGGGGR 54 Query: 564 GXGGAG 547 G GG G Sbjct: 55 G-GGRG 59 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG-GXXXGGGGAGGGXGXXXXXGAXGXGGGXG-GXGGG 536 G GGGG G G GGGG G G G G G GGG G G GGG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G GGG GG Sbjct: 14 GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G GG GGGG G G G GGG G G G GG G Sbjct: 2 GFGKPRGGGGGGGR--GFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G GG GG GGG G G G G GG G G GG Sbjct: 13 GGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGG 51 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GGG G GGGG GGG GG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GG G G G G G G G GG GGG GG GG Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 42.7 bits (96), Expect = 7e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G G GG G GGG GG GG G G G GGG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GG GG GGGG GGG G G G GGG G G Sbjct: 24 GGRGFGGGGGGRGGGGGRGGGGGFGR--GGGGRGGGRGAFDTG 64 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G GG G GG G GGG G GG GG G G GGGG Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G G GG G GGGG G G G GG G G GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGG 45 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 GG GRG GG GGGG G G GG G G G Sbjct: 22 GGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G GGG G GGG G GGG G Sbjct: 14 GRGFGGGGGG-GGRGFGGGGGGRGGGGGRGGGGGFGRGGG--GRGGGRG 59 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 56.4 bits (130), Expect = 5e-08 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGGG GG GGGG GGG G G G GGG GG GG G G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 54.8 bits (126), Expect = 2e-07 Identities = 27/61 (44%), Positives = 27/61 (44%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG G GG GG G G GGG G G G GG G G GG G GG Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGG 232 Query: 537 G 535 G Sbjct: 233 G 233 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/62 (45%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -3 Query: 729 GGXXGGXXGGPGGG-GXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGG 553 GG GG GG GGG G GG G G GGG G G G G G G G G GG Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Query: 552 AG 547 G Sbjct: 234 RG 235 Score = 52.0 bits (119), Expect = 1e-06 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG G GGG GG G GG GG G G G GG G Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Query: 582 XG 577 G Sbjct: 234 RG 235 Score = 49.2 bits (112), Expect = 8e-06 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G P GGG GG G G GGG GG G G GG G G GG G GGG Sbjct: 4 GKPRGGGGGG---GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 49.2 bits (112), Expect = 8e-06 Identities = 31/69 (44%), Positives = 31/69 (44%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 GG GGGG GG G G GGG GG G G G GG G GG G GGG Sbjct: 174 GGGGGGGFGGR--GGGRGGGGRGG------GGGRGGGGFRGGAGR---NGGGGGGGGFNR 222 Query: 525 XXGGAXXGG 499 GG GG Sbjct: 223 GRGGGGGGG 231 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG GG G G G G GG GG G G GG G G GG G G Sbjct: 175 GGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGR 234 Query: 537 G 535 G Sbjct: 235 G 235 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG GGGG GG G G G GGG GG G G G G Sbjct: 185 GGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRG 235 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G GG G G G G GG GRGGGG G G GG Sbjct: 7 RGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGG-GFGRGGGGRGGG 57 Score = 47.6 bits (108), Expect = 3e-05 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG-GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G GG GG GGG G GGG G G G GG GG GG G G G Sbjct: 177 GGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGG 232 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 665 GXXGRG-GXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GRG G GG G G GG GG G G G GG GRGGGG G Sbjct: 11 GGGGRGFGGGGGGGGRGFGGGGGGRGGGG-GRGGGGGFGRGGGGRG 55 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGG-GAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GG G GG GGG G GGG G G G GGG G GGG G Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 46.4 bits (105), Expect = 6e-05 Identities = 30/66 (45%), Positives = 30/66 (45%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G G G GG G GGGG GG G G GGG GG G G G GG G G Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGR-GFGGGGGGRGG------GGGRGGGGGFGRGGGGR 54 Query: 564 GXGGAG 547 G GG G Sbjct: 55 G-GGRG 59 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/45 (53%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG-GXXXGGGGAGGGXGXXXXXGAXGXGGGXG-GXGGG 536 G GGGG G G GGGG G G G G G GGG G G GGG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 52 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G GGG GG Sbjct: 14 GRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G R GGG GG G G GGGGGG Sbjct: 183 GRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGG 232 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG G GG GGGG G G G GGG G G G GG G Sbjct: 2 GFGKPRGGGGGGGR--GFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G GG GG GGG G G G G GG G G GG Sbjct: 13 GGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGG 51 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGX---GXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG GG GGGG GGG G G G GG G GGG G G Sbjct: 182 GGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRG 235 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GGG G GGGG GGG GG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGG 56 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GG G G G G G G G GG GGG GG GG Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 42.7 bits (96), Expect = 7e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G G GG G GGG GG GG G G G GGG Sbjct: 9 GGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GGG G GG G G GGGGGG Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGG-GFRGGAGRNGGGGGGGG 219 Score = 42.3 bits (95), Expect = 0.001 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXG-GXGXGXGXGGXXG----RGGGGXGXXXXXGXXXGG 498 RGG GG G G GG G G G G G GG G GGGG G G GG Sbjct: 172 RGGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGG 228 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GG GG GGGG GGG G G G GGG G G Sbjct: 24 GGRGFGGGGGGRGGGGGRGGGGGFGR--GGGGRGGGRGAFDTG 64 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGG---XXGXGGGGGG 813 G G G G G GG G R G G G GGGG G GGGGGG Sbjct: 178 GGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGG 230 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G GG G GG G GGG G GG GG G G GGGG Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 53 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G G GG G GGGG G G G GG G G GG Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGG 45 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 GG GRG GG GGGG G G GG G G G Sbjct: 22 GGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G GGG G GGG G GGG G Sbjct: 14 GRGFGGGGGG-GGRGFGGGGGGRGGGGGRGGGGGFGRGGG--GRGGGRG 59 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 56.0 bits (129), Expect = 7e-08 Identities = 36/105 (34%), Positives = 36/105 (34%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GG GGG G G G G G G GG Sbjct: 220 GQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQ 279 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G G GG G GG GGGG GG G GGG Sbjct: 280 GGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGQ---GGNMGGG 321 Score = 54.8 bits (126), Expect = 2e-07 Identities = 45/141 (31%), Positives = 45/141 (31%), Gaps = 2/141 (1%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GGGG G G GG G GG G G G G Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQN-----------------GGGNWGGAG 242 Query: 735 XXGGXX--GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG 562 GG GG GG GGG GG G GG G G GG G G Sbjct: 243 GGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGS 302 Query: 561 XGGAGXGGGXXPXXGGAXXGG 499 GG G GGG GG GG Sbjct: 303 WGGNGGGGGG--GQGGNMGGG 321 Score = 45.6 bits (103), Expect = 1e-04 Identities = 33/124 (26%), Positives = 34/124 (27%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 +GG GG GG G G GG G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQ 258 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GG GG G G G G G G G GG Sbjct: 259 GGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYG-GGNSNGSWGGNGGGGGGGQGGN 317 Query: 588 XGXG 577 G G Sbjct: 318 MGGG 321 Score = 41.5 bits (93), Expect = 0.002 Identities = 43/143 (30%), Positives = 43/143 (30%), Gaps = 4/143 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGGAGGGGG------- 246 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G G GG GG Sbjct: 247 -------FGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNS 299 Query: 614 GXGXGGXGGXGXGXGXGGXXGRG 546 GG GG G G G GG G G Sbjct: 300 NGSWGGNGG-GGGGGQGGNMGGG 321 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG GG GG G GG G G GG G G GG Sbjct: 255 GGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG 293 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GRGG G GG G G GG G GG G G GG Sbjct: 201 GGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGG 256 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 55.6 bits (128), Expect = 1e-07 Identities = 32/77 (41%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXX 565 G G GG GPGGGG G G G +G G GG G G G G G G Sbjct: 766 GEVRGGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGS 825 Query: 564 GXGGAGXGGGXXPXXGG 514 G GG G GGG GG Sbjct: 826 GTGGGGLGGGKGKKPGG 842 Score = 53.6 bits (123), Expect = 4e-07 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GG GG G G G G G G GG G G G GG G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGR-GAGSGGWSSGPGGGGSGGGG--GSGGWGSGTGGG 818 Query: 549 GXGGGXXPXXGGAXXGG 499 G GG GG GG Sbjct: 819 GSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 38/105 (36%), Positives = 40/105 (38%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G RGG GG GGGG +G G G+G G G G GG Sbjct: 766 GEVRGGGGGPGPGPGGGG-SGRGAGSG-GWSSGPGGGG---------------------- 801 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G G GG GG G GGGG GG G G GG Sbjct: 802 -SGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG---GKGKKPGG 842 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPG-GGGSGGGGGSGGWGSGTGGGG 819 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXG 859 G G GG GG GGGG G G G G GG G Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 37.5 bits (83), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGGG 813 G G G GG G G GGG GG G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG G G GG G GGG G G G G G GGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 959 AGXGAGGXGXGGX-GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 +G G GG G GG G G G GG G GG G GG Sbjct: 795 SGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG-GXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GG G G GGG G G GG Sbjct: 792 GWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 55.6 bits (128), Expect = 1e-07 Identities = 32/77 (41%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXX 565 G G GG GPGGGG G G G +G G GG G G G G G G Sbjct: 766 GEVRGGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGS 825 Query: 564 GXGGAGXGGGXXPXXGG 514 G GG G GGG GG Sbjct: 826 GTGGGGLGGGKGKKPGG 842 Score = 53.6 bits (123), Expect = 4e-07 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GG GG G G G G G G GG G G G GG G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGR-GAGSGGWSSGPGGGGSGGGG--GSGGWGSGTGGG 818 Query: 549 GXGGGXXPXXGGAXXGG 499 G GG GG GG Sbjct: 819 GSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 38/105 (36%), Positives = 40/105 (38%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G RGG GG GGGG +G G G+G G G G GG Sbjct: 766 GEVRGGGGGPGPGPGGGG-SGRGAGSG-GWSSGPGGGG---------------------- 801 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G G GG GG G GGGG GG G G GG Sbjct: 802 -SGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG---GKGKKPGG 842 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPG-GGGSGGGGGSGGWGSGTGGGG 819 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXG 859 G G GG GG GGGG G G G G GG G Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 37.5 bits (83), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGGG 813 G G G GG G G GGG GG G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG G G GG G GGG G G G G G GGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 959 AGXGAGGXGXGGX-GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 +G G GG G GG G G G GG G GG G GG Sbjct: 795 SGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG-GXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GG G G GGG G G GG Sbjct: 792 GWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 55.6 bits (128), Expect = 1e-07 Identities = 32/77 (41%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXX 565 G G GG GPGGGG G G G +G G GG G G G G G G Sbjct: 766 GEVRGGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGS 825 Query: 564 GXGGAGXGGGXXPXXGG 514 G GG G GGG GG Sbjct: 826 GTGGGGLGGGKGKKPGG 842 Score = 53.6 bits (123), Expect = 4e-07 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GG GG G G G G G G GG G G G GG G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGR-GAGSGGWSSGPGGGGSGGGG--GSGGWGSGTGGG 818 Query: 549 GXGGGXXPXXGGAXXGG 499 G GG GG GG Sbjct: 819 GSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 38/105 (36%), Positives = 40/105 (38%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G RGG GG GGGG +G G G+G G G G GG Sbjct: 766 GEVRGGGGGPGPGPGGGG-SGRGAGSG-GWSSGPGGGG---------------------- 801 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G G GG GG G GGGG GG G G GG Sbjct: 802 -SGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG---GKGKKPGG 842 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAG-GXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G GG G GGG GG GG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPG-GGGSGGGGGSGGWGSGTGGGG 819 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXG 859 G G GG GG GGGG G G G G GG G Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 37.5 bits (83), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG-GXXGXGGGGGG 813 G G G GG G G GGG GG G G G G GG G G Sbjct: 776 GPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG G G GG G GGG G G G G G GGG Sbjct: 787 GAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 959 AGXGAGGXGXGGX-GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 +G G GG G GG G G G GG G GG G GG Sbjct: 795 SGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG-GXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GG G G GGG G G GG Sbjct: 792 GWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 >X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. Length = 326 Score = 55.2 bits (127), Expect = 1e-07 Identities = 41/121 (33%), Positives = 41/121 (33%), Gaps = 3/121 (2%) Frame = -3 Query: 891 GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGG 712 G G G GG G GG GA G G G G GG GG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGG---GFGNSGGNFGG 256 Query: 711 XXGGPGGGGX--GGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 GG GG GG G GGG GG G G G G G G GG G G Sbjct: 257 GQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGQG 316 Query: 540 G 538 G Sbjct: 317 G 317 Score = 54.0 bits (124), Expect = 3e-07 Identities = 37/106 (34%), Positives = 37/106 (34%), Gaps = 1/106 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GG GGG G G G G G G GG Sbjct: 220 GQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQ 279 Query: 777 XXGAXG-XGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G G G GG G GG GGGG GG G GGG Sbjct: 280 GGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGGQ---GGNMGGG 322 Score = 53.2 bits (122), Expect = 5e-07 Identities = 47/144 (32%), Positives = 47/144 (32%), Gaps = 5/144 (3%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GGGG G G GG G GG G G G G Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQN-----------------GGGNWGGAG 242 Query: 735 XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG-----XGXGXGGXXGXGXX 571 GG G GG GGG GG G GG GG G G G GG G G Sbjct: 243 GGGGF--GNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNS 300 Query: 570 XXGXGGAGXGGGXXPXXGGAXXGG 499 GG G GGG GG GG Sbjct: 301 NGSWGGNGGGGGG--GQGGNMGGG 322 Score = 44.8 bits (101), Expect = 2e-04 Identities = 35/109 (32%), Positives = 35/109 (32%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG GG GG GG G G G G GG G G Sbjct: 234 GGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSG------------------GGP 275 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG GG G G GG GG Sbjct: 276 WNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG---GGGGQGGNMGG 321 Score = 42.3 bits (95), Expect = 0.001 Identities = 42/143 (29%), Positives = 42/143 (29%), Gaps = 4/143 (2%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGGXXXXXX 795 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 200 GGGGGRGGPRAGGRGGQGDRGQG------GGGWGGQNRQNGGGNWGGAGGGGG------- 246 Query: 794 XXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXX 615 GG G G G G GG GG Sbjct: 247 -------FGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGN 299 Query: 614 GXGXGGXGGXGXGXGXGGXXGRG 546 G G G G G G GG G G Sbjct: 300 SNGSWGGNGGGGGGGQGGNMGGG 322 Score = 37.1 bits (82), Expect = 0.036 Identities = 40/136 (29%), Positives = 40/136 (29%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXX 777 G G G G GG G GGG G GG G G GGG Sbjct: 215 GQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS------------ 262 Query: 776 XXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGG 597 G GGP G G G GG GG G G GG Sbjct: 263 GGWNQQGGSGGGPWNNQG------------GGNGGWNGGGGGGGYGGGNSNGSWG-GNGG 309 Query: 596 XGGXGXGXGXGGXXGR 549 GG G G GG R Sbjct: 310 GGGGGQGGNMGGGNRR 325 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GRGG G GG G G GG G GG G G GG Sbjct: 201 GGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGG 256 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 +GG GG G G G G G G G GG + GGG G G Sbjct: 199 QGGGGGRGGPRAGGRGGQGDRGQG-GGGWGGQNRQNGGGNWGGAGGGGGFG 248 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 402 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 462 PAPGGPGAPPPPPP 475 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 412 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 337 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 395 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 396 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 455 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 456 MGGGPPPAPGGPGAPPPPPPPP 477 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 404 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 462 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 343 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 402 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 403 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 451 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 452 APPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 453 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 357 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 415 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 448 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 464 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 465 GGPGAPPPPPPP 476 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 405 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 464 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 465 PAPGGPGAPPPPPP 478 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 415 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 473 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 340 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 398 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 399 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 458 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 459 MGGGPPPAPGGPGAPPPPPPPP 480 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 407 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 465 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 346 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 405 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 406 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 454 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 455 APPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 456 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 360 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 417 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 418 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 451 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 442 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 467 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 468 GGPGAPPPPPPP 479 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 548 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 607 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 608 PAPGGPGAPPPPPP 621 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 558 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 616 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 617 PPPPPPPGLGGAPKKEDP 634 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 483 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 541 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 542 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 601 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 602 MGGGPPPAPGGPGAPPPPPPPP 623 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 550 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 608 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 489 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 548 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 549 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 597 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 598 APPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 547 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 599 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 503 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 560 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 561 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 594 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 585 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 623 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 551 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 610 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 611 GGPGAPPPPPPP 622 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 547 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 606 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 607 PAPGGPGAPPPPPP 620 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 557 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 615 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 616 PPPPPPPGLGGAPKKEDP 633 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 482 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 540 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 541 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 600 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 601 MGGGPPPAPGGPGAPPPPPPPP 622 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 549 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 607 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 488 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 547 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 548 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 596 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 597 APPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 546 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 598 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 502 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 559 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 560 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 593 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 584 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 622 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 550 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 609 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 610 GGPGAPPPPPPP 621 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 402 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 462 PAPGGPGAPPPPPP 475 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 412 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 337 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 395 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 396 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 455 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 456 MGGGPPPAPGGPGAPPPPPPPP 477 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 404 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 462 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 343 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 402 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 403 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 451 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 452 APPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 453 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 357 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 415 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 448 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 464 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 465 GGPGAPPPPPPP 476 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 402 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 462 PAPGGPGAPPPPPP 475 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 412 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 337 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 395 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 396 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 455 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 456 MGGGPPPAPGGPGAPPPPPPPP 477 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 404 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 462 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 343 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 402 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 403 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 451 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 452 APPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 453 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 357 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 415 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 448 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 464 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 465 GGPGAPPPPPPP 476 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 402 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 462 PAPGGPGAPPPPPP 475 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 412 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 470 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 337 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 395 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 396 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 455 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 456 MGGGPPPAPGGPGAPPPPPPPP 477 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 404 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 462 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 343 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 402 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 403 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 451 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 452 APPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 453 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 357 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 415 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 448 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 439 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 464 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 465 GGPGAPPPPPPP 476 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPP 691 G P P P PP P PP P P PP PPPA P P PP Sbjct: 405 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 464 Query: 692 P-PGPPXXPPXXPP 730 P PG P PP PP Sbjct: 465 PAPGGPGAPPPPPP 478 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX-PXPXPXXXXXXPPXPPPAXPXPXXX 676 PP G PPP PAPP P P P P P PPPA P Sbjct: 415 PPPSFGGAAGGGPPP-PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAP 473 Query: 677 PPXPPPPGPPXXPPXXPP 730 PP PPPPG P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 46.8 bits (106), Expect = 4e-05 Identities = 36/142 (25%), Positives = 36/142 (25%), Gaps = 5/142 (3%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPX-PXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 P P P P P P PP PP P PP P P Sbjct: 340 PQAHPQAPQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPP-PMNPSQQQQPGQVPLNRM 398 Query: 709 XXXXXPX----PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPP PPP PP PP Sbjct: 399 SSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPA 458 Query: 877 XXXXXXXXXXXXXXPXPPXPXP 942 P PP P P Sbjct: 459 MGGGPPPAPGGPGAPPPPPPPP 480 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P PPP P P PPPP PP PP P P P Sbjct: 407 PPAPAPPPPPPSFGGAAGGGPPPPAP-PQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPP 465 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/145 (26%), Positives = 39/145 (26%), Gaps = 8/145 (5%) Frame = +2 Query: 551 APPXPXXXXPXPXXPPXPXPXPXXXXXXP--PXPPPAXPXPXXXPPXPP-----PPGPPX 709 AP P P PP P P P PPP P P P G P Sbjct: 346 APQAPTMPGPGYGGPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPG 405 Query: 710 XPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPX 889 PP P P P PP P P PAP Sbjct: 406 GPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGA-----------PPPPAMGGGPPPAPP 454 Query: 890 PXPAXPP-PPXXXXXPPXPPRPXPP 961 PA PP P PP P PP Sbjct: 455 APPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP-----XPXPXXXXXXXPPSPPRP 657 P P PPPP P P PP PP P P PP+PP P Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAP 456 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 7/95 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P PPA P P Sbjct: 360 PP--VPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 417 Query: 680 P-------XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PPPP PP PP P P P Sbjct: 418 SFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPP 451 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP 594 P PP P PPP P P P P P PP Sbjct: 442 PPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 31.9 bits (69), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 12/72 (16%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP----XXPPXP----XPXPXPPXPP----XPXPXX 621 P PP PPP P PP P P P PP PP P P Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAP 467 Query: 622 XXXXXPPSPPRP 657 PP PP P Sbjct: 468 GGPGAPPPPPPP 479 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 54.0 bits (124), Expect = 3e-07 Identities = 28/80 (35%), Positives = 28/80 (35%) Frame = +2 Query: 518 PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 P G P PAPP P P PP P P P PP P P PP PP P Sbjct: 21 PAAGGYDYPQPAPPAPVKSY-IPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Query: 698 GPPXXPPXXPPXXPXPXXXP 757 PP P P P Sbjct: 80 KNTYIPPAPAPVAPVETYIP 99 Score = 48.4 bits (110), Expect = 1e-05 Identities = 29/86 (33%), Positives = 29/86 (33%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P AP PPP P PP P P P P PP PPP P P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIP-----PPPPPPPPAPKNTYIP 85 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P P PP P P P Sbjct: 86 PAPAPVAP--VETYIPPAAPAPAYIP 109 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PPP P AP P PP AP PP PPPP P Sbjct: 42 PPPPPPPPPAPKNTYIP-PPAAPAKAYIPPPPPPPPPAP 79 Score = 42.3 bits (95), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P PP P PPPP PP P P PP P PP P P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXP-PXPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 P P P PP PPP P P P P P PP PP P P P A Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPA 87 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P PA P P P PP P P PP P P P P Sbjct: 44 PPPPPPPAPKNTYIPPPAAPAKAYIPPPP-PPPPPAP---KNTYIPPAPAPVAPVETYIP 99 Query: 680 PXPPPPG--PP 706 P P P PP Sbjct: 100 PAAPAPAYIPP 110 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 PP AP PP PA PP P P P P P P PPA P P Sbjct: 47 PPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIP-PAPAPVAPVETYIPPAAPAP 105 Query: 668 XXXPPXP 688 PP P Sbjct: 106 AYIPPAP 112 Score = 36.7 bits (81), Expect = 0.048 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 7/56 (12%) Frame = +3 Query: 519 PSXXXXPPPXPPXPP-------PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P+ PPP PP PP P AP PPA P P PP P P Sbjct: 63 PAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEEP 118 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP----XPPAPXP 957 PPPPP P PP P PP P PP P PPAP P Sbjct: 42 PPPPPPP--PPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPX----PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PP P P P PPP PP P PP Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPP 75 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPP-PPXXXXXPPXPPRPXP 958 P P PP PAP PP P PP PP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 13/62 (20%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXP-----PXPPPXXXXXXXXXXXXXXPXPPXP-----XPPAPX 954 PPPPPP P PPP P P PPP P P P P AP Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPA 104 Query: 955 PA 960 PA Sbjct: 105 PA 106 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P PP P PP P P PP PP P Sbjct: 29 PQPAPPAPVKSYIPPPPPP-PPPAPKNTYIPP-PAAPAKAYIPPPPPPPPPAP 79 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P PP PP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PPPP PP P PP P P PP+ P P Sbjct: 52 PKNTYIPPPAAPAKAYIPPPPPPP----PPAPKNTYIPPAPAPVAP--VETYIPPAAPAP 105 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 3/52 (5%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPP---XPXXPPPPXPPXP 870 P P P PP PPPPPP PP P P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAP 93 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 54.0 bits (124), Expect = 3e-07 Identities = 30/64 (46%), Positives = 31/64 (48%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG GG GGGG GG G G +G G GG G G G G G G G GG Sbjct: 25 GGGGGGGYGGGGGGGYGG--GGGGQSGYGGGGQKNGGGGHGGGGQGSYG-GGSQGGHGGG 81 Query: 549 GXGG 538 G GG Sbjct: 82 GQGG 85 Score = 52.4 bits (120), Expect = 9e-07 Identities = 27/69 (39%), Positives = 28/69 (40%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG GGG GG G G G GG G G G GG G G G G G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQG 84 Query: 537 GXXPXXGGA 511 G GG+ Sbjct: 85 GWQKKGGGS 93 Score = 50.8 bits (116), Expect = 3e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG GGG G G G G GG GGG G G G Sbjct: 25 GGGGGGGYGGG--GGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGG 77 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GG GGGG G G G GGG G G G GG G G G G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GGGG G G G G GGG G GGG G G G Sbjct: 30 GGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGG 85 Score = 46.4 bits (105), Expect = 6e-05 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGG--GXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G GG GG GG GGG G GG G G G GG G G GG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQ 83 Query: 582 XGXXXXGXG 556 G G G Sbjct: 84 GGWQKKGGG 92 Score = 43.2 bits (97), Expect = 5e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G G G GGG G GGG G GGGG G Sbjct: 35 GGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQG 84 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G G GG GG G G GG G G GGG G G G GG G Sbjct: 28 GGGGYGGGGGGG--YGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGG 85 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG---GXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GG G GG GGGG GGG G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXG----GGGXXGXGGGGG 816 G G GG G GG G GGG GG G GGG G GGGG Sbjct: 30 GGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGG 82 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G G G + GGG G GG G G G GG Sbjct: 29 GGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGG 77 Score = 35.5 bits (78), Expect = 0.11 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGP---GGGGXGGXXXGXGXAGGG-XGGXXXXXXGXGXGXG 595 G G G G GG G GG GGGG GG G G GGG GG G G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG--GQGSYGGGSQGGHGGGGQGGWQKKG 90 Query: 594 G 592 G Sbjct: 91 G 91 Score = 35.1 bits (77), Expect = 0.15 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGX-GGXGGGGXXGXGGGGGG 813 G G G G G GG GGG GG GGGG G GGG Sbjct: 42 GGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKKGGG 92 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GGG GG G G G G G G G G GG GGG G GG Sbjct: 21 GLLGGGGGGGGY---GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 33.5 bits (73), Expect = 0.44 Identities = 28/86 (32%), Positives = 28/86 (32%) Frame = -3 Query: 933 GXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXG 754 G GGGG G G G G GG G G G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSG---------------------YGGGGQKNGG 59 Query: 753 XXXGXGXXGGXXGGXXGGPGGGGXGG 676 G G G GG GG GGGG GG Sbjct: 60 GGHGGGGQGSYGGGSQGGHGGGGQGG 85 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGX-GGXGGGXXXXXGXGXXXG 500 GGGG GGG G G GGG GG GGG G G G Sbjct: 24 GGGGGGGGYG--------GGGGGGYGGGGGGQSGYGGGGQKNG 58 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGG 816 G GG GGGG G GGGGG Sbjct: 21 GLLGGGGGGGGYGGGGGGG 39 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 G GG GG GGG G G G GG G G Sbjct: 58 GGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKKGGG 92 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 54.0 bits (124), Expect = 3e-07 Identities = 28/80 (35%), Positives = 28/80 (35%) Frame = +2 Query: 518 PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 P G P PAPP P P PP P P P PP P P PP PP P Sbjct: 21 PAAGGYDYPQPAPPAPVKSY-IPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Query: 698 GPPXXPPXXPPXXPXPXXXP 757 PP P P P Sbjct: 80 KNTYIPPAPAPVAPVETYIP 99 Score = 48.4 bits (110), Expect = 1e-05 Identities = 29/86 (33%), Positives = 29/86 (33%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P AP PPP P PP P P P P PP PPP P P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIP-----PPPPPPPPAPKNTYIP 85 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P P PP P P P Sbjct: 86 PAPAPVAP--VETYIPPAAPAPAYIP 109 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PPP P AP P PP AP PP PPPP P Sbjct: 42 PPPPPPPPPAPKNTYIP-PPAAPAKAYIPPPPPPPPPAP 79 Score = 42.3 bits (95), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P PP P PPPP PP P P PP P PP P P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXP-PXPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 P P P PP PPP P P P P P PP PP P P P A Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPA 87 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P PA P P P PP P P PP P P P P Sbjct: 44 PPPPPPPAPKNTYIPPPAAPAKAYIPPPP-PPPPPAP---KNTYIPPAPAPVAPVETYIP 99 Query: 680 PXPPPPG--PP 706 P P P PP Sbjct: 100 PAAPAPAYIPP 110 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 PP AP PP PA PP P P P P P P PPA P P Sbjct: 47 PPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIP-PAPAPVAPVETYIPPAAPAP 105 Query: 668 XXXPPXP 688 PP P Sbjct: 106 AYIPPAP 112 Score = 36.7 bits (81), Expect = 0.048 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 7/56 (12%) Frame = +3 Query: 519 PSXXXXPPPXPPXPP-------PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P+ PPP PP PP P AP PPA P P PP P P Sbjct: 63 PAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEEP 118 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP----XPPAPXP 957 PPPPP P PP P PP P PP P PPAP P Sbjct: 42 PPPPPPP--PPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPX----PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PP P P P PPP PP P PP Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPP 75 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPP-PPXXXXXPPXPPRPXP 958 P P PP PAP PP P PP PP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 13/62 (20%) Frame = +1 Query: 814 PPPPPPXPXX---PPPPXP-----PXPPPXXXXXXXXXXXXXXPXPPXP-----XPPAPX 954 PPPPPP P PPP P P PPP P P P P AP Sbjct: 45 PPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPA 104 Query: 955 PA 960 PA Sbjct: 105 PA 106 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P PPPP P PP P PP P P PP PP P Sbjct: 29 PQPAPPAPVKSYIPPPPPP-PPPAPKNTYIPP-PAAPAKAYIPPPPPPPPPAP 79 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P PP PP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PPPP PP P PP P P PP+ P P Sbjct: 52 PKNTYIPPPAAPAKAYIPPPPPPP----PPAPKNTYIPPAPAPVAP--VETYIPPAAPAP 105 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 3/52 (5%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPP---XPXXPPPPXPPXP 870 P P P PP PPPPPP PP P P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAP 93 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGG-PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXX 568 G G GG GG GG P GGG GG G G GG GG G G G G G G Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGG--R 85 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GGA GG Sbjct: 86 GGGGGAASASASSSASAAGGGGG 108 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG GG GGG G G G GGG GG G G GG G G G Sbjct: 26 GFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGG-GPYGGGFGNPYGGGFGGGRRHGGG 84 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 G G G A G Sbjct: 85 RGGGGGAASASASSSASAAG 104 Score = 50.8 bits (116), Expect = 3e-06 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 4/78 (5%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGG-PGGGGXGGXXXGXGXA---GGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GG P GGG GG G G GGG GG G G G GG Sbjct: 33 GGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG--GRRHGGGRGGGGG 90 Query: 588 XGXGXXXXGXGGAGXGGG 535 AG GGG Sbjct: 91 AASASASSSASAAGGGGG 108 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 G G G GG GG G P GGG GG G GGG G GG G Sbjct: 51 GGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAA 110 Query: 576 XXXXGXGGAGXGGG 535 + GGG Sbjct: 111 SSSASSSASASGGG 124 Score = 39.1 bits (87), Expect = 0.009 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 5/74 (6%) Frame = -3 Query: 705 GGPGGG-GXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXXXGXG---GAGXG 541 G PG G G GG G G GG GG G G G GG G G G G G G G Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGG------GFGGGPYGGGFGGGPYGGGFGNPYGGGFG 76 Query: 540 GGXXPXXGGAXXGG 499 GG G GG Sbjct: 77 GGRRHGGGRGGGGG 90 Score = 38.3 bits (85), Expect = 0.016 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -3 Query: 687 GXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 G G G G GG GG G G G GG G G G GG GGG GG Sbjct: 21 GFGRPGFGGGFGGGPYGG------GFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGG 74 Query: 510 XXGG 499 GG Sbjct: 75 FGGG 78 Score = 36.3 bits (80), Expect = 0.063 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 5/73 (6%) Frame = -3 Query: 714 GXXGGPGGGGXG--GXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 G G GG G G G G G GGG GG G G G GG G G GG G G Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGGGFGG---GPYGGGFG-GGPYGGGFGNPYGGGFGGG 78 Query: 540 ---GGXXPXXGGA 511 GG GGA Sbjct: 79 RRHGGGRGGGGGA 91 Score = 35.5 bits (78), Expect = 0.11 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 1/123 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G G GG GGG G G G GG G G GG Sbjct: 26 GFGGGFGGGPYGGGFGGGPYGGGFG---GGPYGGGFGG---------------------- 60 Query: 777 XXGAXGXGXXXGXGXXGG-XXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GG AGGG G Sbjct: 61 GPYGGGFGNPYGGGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASA 120 Query: 600 XGG 592 GG Sbjct: 121 SGG 123 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGX---GGXGGGGXXGXGGGGGG 813 G G G G G G G G G GG GGG G G GGGG Sbjct: 37 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 646 GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GGG GG G G G G G G GGG Sbjct: 21 GFGRPGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGG 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G G G G GGG GGG GG Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG 77 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GG GGGGA A G GG G G Sbjct: 74 GFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASASGGG 124 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -1 Query: 962 GAGXGAGGXGXG--GXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G GG G G G G GGG GG G G GGGGG Sbjct: 41 GGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG-GRRHGGGRGGGGG 90 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG G GGGG A G GGG G G Sbjct: 73 GGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASASGGGFYG 127 >AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p protein. Length = 562 Score = 53.6 bits (123), Expect = 4e-07 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P P P P P P P P P P P P P P P PP Sbjct: 53 PTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPP 112 Query: 683 XP-PPPGPPXXPPXXPPXXPXP 745 P PPP P PP P P Sbjct: 113 KPTPPPAKPSSPPKQADKMPIP 134 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P P P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAP-KPDPPKPAPAVAKPTPVPVPATAPAPPKEE 94 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P P P P P P P Sbjct: 95 PAPKPKPEPVPSPVVAPPKPTP 116 Score = 47.6 bits (108), Expect = 3e-05 Identities = 30/96 (31%), Positives = 31/96 (32%), Gaps = 8/96 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA--PPXPXXXXPXPXXP---PXPXPXPXXXXXXPPXPPPAXPX 664 P + P P P PA PP P P P P P P P P P P Sbjct: 41 PAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPK 100 Query: 665 PXXXPPX---PPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P PP P PP P P Sbjct: 101 PEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIPLP 136 Score = 46.0 bits (104), Expect = 8e-05 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P PAP P P P P P PP P PA P P P P P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPT---PVPVPATAPAPPK 92 Query: 719 XXPPXXPXPXXXPXP 763 P P P P P Sbjct: 93 EEPAPKPKPEPVPSP 107 Score = 35.1 bits (77), Expect = 0.15 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 3/101 (2%) Frame = +2 Query: 650 PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXX 829 PA P P P P P P PP P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEP 95 Query: 830 XXXXXP-PXPXPXX-PPXPAPXP-XPAXPPPPXXXXXPPXP 943 P P P P PP P P P P+ PP P P Sbjct: 96 APKPKPEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIPLP 136 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P PAP P P P P PP+P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAP 73 Score = 31.9 bits (69), Expect = 1.4 Identities = 26/112 (23%), Positives = 27/112 (24%), Gaps = 1/112 (0%) Frame = +1 Query: 544 PPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP-PRPXXPXXXXXXXXXXXXXXXXXX 720 P P P P P P P PP+P P P P Sbjct: 30 PALDNKPANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPV------ 83 Query: 721 XPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP P PPP P PP P P Sbjct: 84 -PATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIP 134 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPX-PPRPXPP 961 P P P P P P PA P P P PP+P PP Sbjct: 80 PVPVPATAPAP-PKEEPAPKPKPEPVPSPVVAPPKPTPP 117 Score = 30.3 bits (65), Expect = 4.1 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 9/62 (14%) Frame = +1 Query: 499 PPXXXPXXXXXPXP---PPPRP-XXPPXPXPXPXPPXP----PXPXPXXXXXXXPP-SPP 651 P P P P P P+P PP P P P P P P P P PP P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEP 95 Query: 652 RP 657 P Sbjct: 96 AP 97 Score = 29.1 bits (62), Expect = 9.5 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 1/59 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP-PXPPXPXPXXXXXXXPPSPP 651 P P P P P P P P P P P P P P PS P Sbjct: 66 PDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTPPPAKPSSP 124 >AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-PA, isoform A protein. Length = 562 Score = 53.6 bits (123), Expect = 4e-07 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P P P P P P P P P P P P P P P PP Sbjct: 53 PTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPP 112 Query: 683 XP-PPPGPPXXPPXXPPXXPXP 745 P PPP P PP P P Sbjct: 113 KPTPPPAKPSSPPKQADKMPIP 134 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P P P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAP-KPDPPKPAPAVAKPTPVPVPATAPAPPKEE 94 Query: 680 PXPPPPGPPXXPPXXPPXXPXP 745 P P P P P P P P Sbjct: 95 PAPKPKPEPVPSPVVAPPKPTP 116 Score = 47.6 bits (108), Expect = 3e-05 Identities = 30/96 (31%), Positives = 31/96 (32%), Gaps = 8/96 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA--PPXPXXXXPXPXXP---PXPXPXPXXXXXXPPXPPPAXPX 664 P + P P P PA PP P P P P P P P P P P Sbjct: 41 PAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPK 100 Query: 665 PXXXPPX---PPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P PP P PP P P Sbjct: 101 PEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIPLP 136 Score = 46.0 bits (104), Expect = 8e-05 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P PAP P P P P P PP P PA P P P P P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPT---PVPVPATAPAPPK 92 Query: 719 XXPPXXPXPXXXPXP 763 P P P P P Sbjct: 93 EEPAPKPKPEPVPSP 107 Score = 35.1 bits (77), Expect = 0.15 Identities = 26/101 (25%), Positives = 27/101 (26%), Gaps = 3/101 (2%) Frame = +2 Query: 650 PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXX 829 PA P P P P P P PP P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEP 95 Query: 830 XXXXXP-PXPXPXX-PPXPAPXP-XPAXPPPPXXXXXPPXP 943 P P P P PP P P P P+ PP P P Sbjct: 96 APKPKPEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIPLP 136 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P PAP P P P P PP+P P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAP 73 Score = 31.9 bits (69), Expect = 1.4 Identities = 26/112 (23%), Positives = 27/112 (24%), Gaps = 1/112 (0%) Frame = +1 Query: 544 PPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP-PRPXXPXXXXXXXXXXXXXXXXXX 720 P P P P P P P PP+P P P P Sbjct: 30 PALDNKPANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPV------ 83 Query: 721 XPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP P PPP P PP P P Sbjct: 84 -PATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTPPPAKPSSPPKQADKMPIP 134 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPX-PPRPXPP 961 P P P P P P PA P P P PP+P PP Sbjct: 80 PVPVPATAPAP-PKEEPAPKPKPEPVPSPVVAPPKPTPP 117 Score = 30.3 bits (65), Expect = 4.1 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 9/62 (14%) Frame = +1 Query: 499 PPXXXPXXXXXPXP---PPPRP-XXPPXPXPXPXPPXP----PXPXPXXXXXXXPP-SPP 651 P P P P P P+P PP P P P P P P P P PP P Sbjct: 36 PANPAPAKESAPAPAPAPTPKPAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEP 95 Query: 652 RP 657 P Sbjct: 96 AP 97 Score = 29.1 bits (62), Expect = 9.5 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 1/59 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP-PXPPXPXPXXXXXXXPPSPP 651 P P P P P P P P P P P P P P PS P Sbjct: 66 PDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTPPPAKPSSP 124 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 53.6 bits (123), Expect = 4e-07 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGG-PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXX 568 G G GG GG GG P GGG GG G G GG GG G G G G G G Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGG--R 85 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GGA GG Sbjct: 86 GGGGGAASASASSSASAAGGGGG 108 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG GG GGG G G G GGG GG G G GG G G G Sbjct: 26 GFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGG-GPYGGGFGNPYGGGFGGGRRHGGG 84 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 G G G A G Sbjct: 85 RGGGGGAASASASSSASAAG 104 Score = 50.8 bits (116), Expect = 3e-06 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 4/78 (5%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGG-PGGGGXGGXXXGXGXA---GGGXGGXXXXXXGXGXGXGGX 589 G G G GG GG GG P GGG GG G G GGG GG G G G GG Sbjct: 33 GGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG--GRRHGGGRGGGGG 90 Query: 588 XGXGXXXXGXGGAGXGGG 535 AG GGG Sbjct: 91 AASASASSSASAAGGGGG 108 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 G G G GG GG G P GGG GG G GGG G GG G Sbjct: 51 GGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAA 110 Query: 576 XXXXGXGGAGXGGG 535 + GGG Sbjct: 111 SSSASSSASASGGG 124 Score = 39.1 bits (87), Expect = 0.009 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 5/74 (6%) Frame = -3 Query: 705 GGPGGG-GXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXXXGXG---GAGXG 541 G PG G G GG G G GG GG G G G GG G G G G G G G Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGG------GFGGGPYGGGFGGGPYGGGFGNPYGGGFG 76 Query: 540 GGXXPXXGGAXXGG 499 GG G GG Sbjct: 77 GGRRHGGGRGGGGG 90 Score = 38.3 bits (85), Expect = 0.016 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -3 Query: 687 GXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 G G G G GG GG G G G GG G G G GG GGG GG Sbjct: 21 GFGRPGFGGGFGGGPYGG------GFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGG 74 Query: 510 XXGG 499 GG Sbjct: 75 FGGG 78 Score = 36.3 bits (80), Expect = 0.063 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 5/73 (6%) Frame = -3 Query: 714 GXXGGPGGGGXG--GXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 G G GG G G G G G GGG GG G G G GG G G GG G G Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGGGFGG---GPYGGGFG-GGPYGGGFGNPYGGGFGGG 78 Query: 540 ---GGXXPXXGGA 511 GG GGA Sbjct: 79 RRHGGGRGGGGGA 91 Score = 35.5 bits (78), Expect = 0.11 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 1/123 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G G GG GGG G G G GG G G GG Sbjct: 26 GFGGGFGGGPYGGGFGGGPYGGGFG---GGPYGGGFGG---------------------- 60 Query: 777 XXGAXGXGXXXGXGXXGG-XXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G G GG GG GG GG AGGG G Sbjct: 61 GPYGGGFGNPYGGGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASA 120 Query: 600 XGG 592 GG Sbjct: 121 SGG 123 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGX---GGXGGGGXXGXGGGGGG 813 G G G G G G G G G GG GGG G G GGGG Sbjct: 37 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 646 GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GGG GG G G G G G G GGG Sbjct: 21 GFGRPGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGG 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G G G G G G GGG GGG GG Sbjct: 28 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG 77 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GG GGGGA A G GG G G Sbjct: 74 GFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASASGGG 124 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -1 Query: 962 GAGXGAGGXGXG--GXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G GG G G G G GGG GG G G GGGGG Sbjct: 41 GGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG-GRRHGGGRGGGGG 90 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG G GGGG A G GGG G G Sbjct: 73 GGFGGGRRHGGGRGGGGGAASASASSSASAAGGGGGAASSSASSSASASGGGFYG 127 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 53.2 bits (122), Expect = 5e-07 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPG---GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGX 574 G G G GG GG G GGG GG G G GGG G G G GG G G Sbjct: 38 GPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGG 97 Query: 573 XXXGXGGAGXGGGXXPXXGG 514 G GG GG G Sbjct: 98 YGGGGGGGYDDGGLTQIISG 117 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGGG GGG G G G GG GGG G G G Sbjct: 54 GYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDG 109 Score = 45.2 bits (102), Expect = 1e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGG--XGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG G GGGG GG G GGG GG G G G G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 570 XXGXGGAGXGG 538 G GG G GG Sbjct: 95 GGGYGGGGGGG 105 Score = 44.0 bits (99), Expect = 3e-04 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG G GG GG G G GG GG G G G G G G G GG Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 537 GXXPXXGGAXXGG 499 G GG GG Sbjct: 95 GG--GYGGGGGGG 105 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXG---GXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G AGG G G G G G G G GGGG G GGGGGG Sbjct: 52 GGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGG 104 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 959 AGXGAGGX-GXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG G GG GG G G G GG GGGG G GGGGG Sbjct: 57 AGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGG 105 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 PGG G G G G GGG G G GG G G G G G G Sbjct: 34 PGGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 Query: 519 GGAXXGG 499 GG GG Sbjct: 94 GGGGYGG 100 Score = 35.9 bits (79), Expect = 0.083 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 GG GG GGGG GGGGGG Sbjct: 44 GGNGGRGGGGGYNAGGGGGG 63 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 929 GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGX 750 GG G GG G GGGG GGGGGG G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 749 XGGPGXGXG 723 GG G G G Sbjct: 95 GGGYGGGGG 103 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXG 871 G GRGG GG GGGG G G G G Sbjct: 45 GNGGRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G GG GG GG G GGGGGG Sbjct: 60 GGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYG----GGGGGG 105 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 G GG G G GGG GG GGGG G GG Sbjct: 67 GGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.7 bits (71), Expect = 0.77 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 681 GGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 GG G G G G G G G G G GG G GGG P G Sbjct: 26 GGCYDCNPPGGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSG 81 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGG 868 GG G G GG GGGG G G G GG Sbjct: 44 GGNGGRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 31.9 bits (69), Expect = 1.4 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G G GGGG G G G G G G GG Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAG-GGGGGYYNGGGGGG--------------------G 73 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGG 685 G G GG GG GG GGGG Sbjct: 74 GRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGG 105 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXG------GGGXXGXGGGGGG 813 G G GG G G G GGG GG G G G G GGGG Sbjct: 38 GPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 53.2 bits (122), Expect = 5e-07 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPG---GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGX 574 G G G GG GG G GGG GG G G GGG G G G GG G G Sbjct: 38 GPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGG 97 Query: 573 XXXGXGGAGXGGGXXPXXGG 514 G GG GG G Sbjct: 98 YGGGGGGGYDDGGLTQIISG 117 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXG-AXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGGG GGG G G G GG GGG G G G Sbjct: 54 GYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDG 109 Score = 45.2 bits (102), Expect = 1e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGG--XGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG G GGGG GG G GGG GG G G G G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 570 XXGXGGAGXGG 538 G GG G GG Sbjct: 95 GGGYGGGGGGG 105 Score = 44.0 bits (99), Expect = 3e-04 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG G GG GG G G GG GG G G G G G G G GG Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 537 GXXPXXGGAXXGG 499 G GG GG Sbjct: 95 GG--GYGGGGGGG 105 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXG---GXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G AGG G G G G G G G GGGG G GGGGGG Sbjct: 52 GGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGG 104 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 959 AGXGAGGX-GXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG G GG GG G G G GG GGGG G GGGGG Sbjct: 57 AGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGG 105 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 PGG G G G G GGG G G GG G G G G G G Sbjct: 34 PGGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 Query: 519 GGAXXGG 499 GG GG Sbjct: 94 GGGGYGG 100 Score = 35.9 bits (79), Expect = 0.083 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 GG GG GGGG GGGGGG Sbjct: 44 GGNGGRGGGGGYNAGGGGGG 63 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 929 GGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGX 750 GG G GG G GGGG GGGGGG G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGG 94 Query: 749 XGGPGXGXG 723 GG G G G Sbjct: 95 GGGYGGGGG 103 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXG 871 G GRGG GG GGGG G G G G Sbjct: 45 GNGGRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G GG GG GG G GGGGGG Sbjct: 60 GGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYG----GGGGGG 105 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 G GG G G GGG GG GGGG G GG Sbjct: 67 GGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.7 bits (71), Expect = 0.77 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 681 GGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 GG G G G G G G G G G GG G GGG P G Sbjct: 26 GGCYDCNPPGGQGPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSG 81 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGG 868 GG G G GG GGGG G G G GG Sbjct: 44 GGNGGRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 31.9 bits (69), Expect = 1.4 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G G GGGG G G G G G G GG Sbjct: 35 GGQGPGVYTGGNGGRGGGGGYNAG-GGGGGYYNGGGGGG--------------------G 73 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGG 685 G G GG GG GG GGGG Sbjct: 74 GRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGG 105 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXG------GGGXXGXGGGGGG 813 G G GG G G G GGG GG G G G G GGGG Sbjct: 38 GPGVYTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 52.8 bits (121), Expect = 7e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -3 Query: 729 GGXXGGXXGGPGGG--GXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GG GG GGG G GG G G G G GG G G G GG G G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG----GRG 692 Query: 555 GAGXGGG 535 G G GGG Sbjct: 693 GGGRGGG 699 Score = 50.0 bits (114), Expect = 5e-06 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG-GGXGGXGGG 536 G GGGG GG GG G GGG G G G G GG GG GGG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GG GGG G G G GG GG GG G G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G R GGG GG G GG G GGGG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G R GGG GG GG G G GGG G Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GRGG G G G GG GG G G G G GRGGGG G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGG-GFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 44.0 bits (99), Expect = 3e-04 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G GG GG G G G GG GRGGGG G G G Sbjct: 644 RGGRGGGGRGG--GGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRG 692 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG G GG GGGG G G G GGG GG G G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGR---GGGGRGGGFG 701 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GG GGG G G G GGG G G G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 42.3 bits (95), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G G G GG GGGG G GG GGG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G G GG GG GG GGG G G G GGG G G G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GRGG G G G GG G G G GG GRGGGG G Sbjct: 657 GFGGRGGGGRGGGGGFGGRGGGGRG----GGGFGGRGGRGGGGRG 697 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 GGG GG G GG G G G G G G GG G GGG GG Sbjct: 620 GGGDGGGFKKIGDRKS-FGGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Query: 513 AXXGG 499 GG Sbjct: 679 GRGGG 683 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G G GGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G G R G G GG GGGG G GGGG Sbjct: 618 GEGGGDGG-GFKKIGDRKSFGGFDNNQRGGRGGGGRGGGGGFGGRGGGG 665 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 RGG GG GGG G G G GG G GG Sbjct: 644 RGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Score = 32.7 bits (71), Expect = 0.77 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = -3 Query: 705 GGPGGGGXGGXXXGX--------GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G G G GG GG G GG G GG Sbjct: 595 GGRGGSGFSGRPDRSTWETNKFNGEGGGDGGG--FKKIGDRKSFGGFDNNQRGGRGGGGR 652 Query: 549 GXGGGXXPXXGGAXXGG 499 G GGG GG GG Sbjct: 653 GGGGGFGGRGGGGRGGG 669 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 52.8 bits (121), Expect = 7e-07 Identities = 35/89 (39%), Positives = 37/89 (41%), Gaps = 5/89 (5%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGGGGXGGXXXGXGXAGG---GXGGXXXXXXGXGXGX 598 G G G G G GG GGPG GG G G G GG G G G G G Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGP 96 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 G G G GG+G GGG P GG+ Sbjct: 97 GFGGGFGGGPGFGGGSGFGGG-RPAVGGS 124 Score = 51.2 bits (117), Expect = 2e-06 Identities = 31/73 (42%), Positives = 31/73 (42%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG G PG GG G G G GGG G G G G GG G G G G GG Sbjct: 36 GGLGGRPGFGGGPGFGGGPGF-GGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGG 94 Query: 537 GXXPXXGGAXXGG 499 G P GG GG Sbjct: 95 G--PGFGGGFGGG 105 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/141 (26%), Positives = 39/141 (27%), Gaps = 1/141 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG-GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GG GG G G G G GG G G G Sbjct: 21 GGNANANANANANAQGGLGGRPGFGGGPGFGGGPGFGGG---PGFGGRPGFGGGPGFGGG 77 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 G G G G G G GG GGPG GG G G GG Sbjct: 78 PGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSGFGGGRPAVGGSSAASASSSASASG 137 Query: 603 GXGGXXGXGXXXXGXGGAGXG 541 G G G +G G Sbjct: 138 GGRGGAGSASASSSANASGGG 158 Score = 44.4 bits (100), Expect = 2e-04 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 2/89 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G G G GG GGPG GG G G GGG G G G G G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGF-GGGPGFGGGFGGGPGFGGGSG 113 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G G A GG G Sbjct: 114 FGGGRPAVGGSSAASASSSASASGGGRGG 142 Score = 42.7 bits (96), Expect = 7e-04 Identities = 32/82 (39%), Positives = 32/82 (39%), Gaps = 2/82 (2%) Frame = -3 Query: 738 GXXGGXXG--GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG G G G GG G GG G G G G G G G GG G G Sbjct: 36 GGLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGG----PGFGGGPGFGGGQGFGGRPG 91 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 GG G GGG GG GG Sbjct: 92 FGGGPGFGGG---FGGGPGFGG 110 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GG G GGG G G G G GG GGG G G G Sbjct: 63 GGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSGFGGG 117 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG----GGXGGXGGGXXXXXGXGXXXG 500 G GG G GG GGG G G G G G GG G GGG G G G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSG 113 Score = 30.3 bits (65), Expect = 4.1 Identities = 28/103 (27%), Positives = 28/103 (27%), Gaps = 1/103 (0%) Frame = -2 Query: 847 GGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXX-GXXXXXXXXXXXXXXXXXXX 671 GG G GGG G G GG G G Sbjct: 45 GGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGG 104 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG G GG G GG A GGG GG G Sbjct: 105 GPGFGGGSGFGG---GRPAVGGSSAASASSSASASGGGRGGAG 144 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 52.8 bits (121), Expect = 7e-07 Identities = 41/126 (32%), Positives = 41/126 (32%), Gaps = 1/126 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GRGG G GGGG G G G G GG G GG Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGG---GGNWQQPQQQQQQQHQNQSYEQRD 392 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGX-GGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G GG GGG GG G G GGG G G G G Sbjct: 393 RSDRNDQQWISGSGRVQGTGWNPQGGRDGGGRDGGGRDGGGRDGGGRG------RGGGGG 446 Query: 600 XGGXXG 583 GG G Sbjct: 447 RGGYRG 452 Score = 44.4 bits (100), Expect = 2e-04 Identities = 36/111 (32%), Positives = 36/111 (32%), Gaps = 2/111 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG RGG GG GGGG G G G GG Sbjct: 342 GGNFRGGRGG----GGGGGFGGGRGGGGGGGGGNWQQPQQQQQQQHQNQSYEQRDRSDRN 397 Query: 780 XXXGAXGXGXXXGXG--XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GGG GG G G GG GG Sbjct: 398 DQQWISGSGRVQGTGWNPQGGRDGG--GRDGGGRDGGGRDGGGRGRGGGGG 446 Score = 39.5 bits (88), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GG GG G GGG G G GGG GG GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGF-----GGGRGGGGGGGGG 370 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G PGGG GG G GGG GG G G G GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G GG G GG GGGG GG G G GGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GGG G G GGG GG GG Sbjct: 418 GRDGGGRDGGGRDGGGRDGGGRG-------RGGGGGRGGYRGG 453 Score = 37.1 bits (82), Expect = 0.036 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGGGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 36.7 bits (81), Expect = 0.048 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 336 GGGRGGGGNFRGGRG--------------GGGGGGFGGGRGGGGGGGGG 370 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 622 GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGG GGG G G GG GG GGG G Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 GG GG GGGG G GGGGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGG 366 Score = 33.5 bits (73), Expect = 0.44 Identities = 33/113 (29%), Positives = 34/113 (30%), Gaps = 2/113 (1%) Frame = -1 Query: 875 GGGX--GGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GGGG G GGG GG Sbjct: 341 GGGNFRGGRGGGGGGGFGGGRGG-GGGGGGGNWQQPQQQQQQQHQNQSYEQRDRSDRNDQ 399 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGG 543 G G +GG G G G G G G G G GG GRGG Sbjct: 400 QWISGSGRVQGTGWNPQGGRDG---GGRDGGGRDGGGRDGGGRGRGGGGGRGG 449 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG GG GGG GGG G G GGG GG GG Sbjct: 417 GGRDGGGRDGGGRDGGGRDG----GGRGRGGG-GGRGG 449 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGG 843 G G G GG G GGG GG GGGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG G GG GG GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGG 369 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GG G GGGGGG Sbjct: 336 GGGRGG-GGNFRGGRGGGGGG 355 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 52.8 bits (121), Expect = 7e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -3 Query: 729 GGXXGGXXGGPGGG--GXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GG GG GGG G GG G G G G GG G G G GG G G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG----GRG 692 Query: 555 GAGXGGG 535 G G GGG Sbjct: 693 GGGRGGG 699 Score = 50.0 bits (114), Expect = 5e-06 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG-GGXGGXGGG 536 G GGGG GG GG G GGG G G G G GG GG GGG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GG GGG G G G GG GG GG G G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G R GGG GG G GG G GGGG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G R GGG GG GG G G GGG G Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GRGG G G G GG GG G G G G GRGGGG G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGG-GFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 44.0 bits (99), Expect = 3e-04 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G GG GG G G G GG GRGGGG G G G Sbjct: 644 RGGRGGGGRGG--GGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRG 692 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG G GG GGGG G G G GGG GG G G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGR---GGGGRGGGFG 701 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GG GGG G G G GGG G G G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 42.3 bits (95), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G G G GG GGGG G GG GGG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G G GG GG GG GGG G G G GGG G G G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GRGG G G G GG G G G GG GRGGGG G Sbjct: 657 GFGGRGGGGRGGGGGFGGRGGGGRG----GGGFGGRGGRGGGGRG 697 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 GGG GG G GG G G G G G G GG G GGG GG Sbjct: 620 GGGDGGGFKKIGDRKS-FGGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Query: 513 AXXGG 499 GG Sbjct: 679 GRGGG 683 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G G GGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G G R G G GG GGGG G GGGG Sbjct: 618 GEGGGDGG-GFKKIGDRKSFGGFDNNQRGGRGGGGRGGGGGFGGRGGGG 665 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 RGG GG GGG G G G GG G GG Sbjct: 644 RGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Score = 32.7 bits (71), Expect = 0.77 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = -3 Query: 705 GGPGGGGXGGXXXGX--------GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G G G GG GG G GG G GG Sbjct: 595 GGRGGSGFSGRPDRSTWETNKFNGEGGGDGGG--FKKIGDRKSFGGFDNNQRGGRGGGGR 652 Query: 549 GXGGGXXPXXGGAXXGG 499 G GGG GG GG Sbjct: 653 GGGGGFGGRGGGGRGGG 669 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 52.8 bits (121), Expect = 7e-07 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -3 Query: 729 GGXXGGXXGGPGGG--GXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GG GG GGG G GG G G G G GG G G G GG G G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRG----GRG 692 Query: 555 GAGXGGG 535 G G GGG Sbjct: 693 GGGRGGG 699 Score = 50.0 bits (114), Expect = 5e-06 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG-GGXGGXGGG 536 G GGGG GG GG G GGG G G G G GG GG GGG Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGGG GG GG GGG G G G GG GG GG G G G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G R GGG GG G GG G GGGG G Sbjct: 648 GGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G GG G R GGG GG GG G G GGG G Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 GRGG G G G GG GG G G G G GRGGGG G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGG-GFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 44.0 bits (99), Expect = 3e-04 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 653 RGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 RGG GG G G GG GG G G G GG GRGGGG G G G Sbjct: 644 RGGRGGGGRGG--GGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRG 692 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG G GG GGGG G G G GGG GG G G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGR---GGGGRGGGFG 701 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GG GGG G G G GGG G G G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 42.3 bits (95), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G G G GG GGGG G GG GGG Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G G GG GG GG GGG G G G GGG G G G G G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 Score = 41.5 bits (93), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 665 GXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GRGG G G G GG G G G GG GRGGGG G Sbjct: 657 GFGGRGGGGRGGGGGFGGRGGGGRG----GGGFGGRGGRGGGGRG 697 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGG 514 GGG GG G GG G G G G G G GG G GGG GG Sbjct: 620 GGGDGGGFKKIGDRKS-FGGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Query: 513 AXXGG 499 GG Sbjct: 679 GRGGG 683 Score = 40.3 bits (90), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXG-GXXXGXGXAGGGXGG 634 G G G G G GG GG GGGG G G G G GGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG G G R G G GG GGGG G GGGG Sbjct: 618 GEGGGDGG-GFKKIGDRKSFGGFDNNQRGGRGGGGRGGGGGFGGRGGGG 665 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 RGG GG GGG G G G GG G GG Sbjct: 644 RGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGG 678 Score = 32.7 bits (71), Expect = 0.77 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = -3 Query: 705 GGPGGGGXGGXXXGX--------GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G G G GG GG G GG G GG Sbjct: 595 GGRGGSGFSGRPDRSTWETNKFNGEGGGDGGG--FKKIGDRKSFGGFDNNQRGGRGGGGR 652 Query: 549 GXGGGXXPXXGGAXXGG 499 G GGG GG GG Sbjct: 653 GGGGGFGGRGGGGRGGG 669 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 52.8 bits (121), Expect = 7e-07 Identities = 35/89 (39%), Positives = 37/89 (41%), Gaps = 5/89 (5%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGGGGXGGXXXGXGXAGG---GXGGXXXXXXGXGXGX 598 G G G G G GG GGPG GG G G G GG G G G G G Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGP 96 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 G G G GG+G GGG P GG+ Sbjct: 97 GFGGGFGGGPGFGGGSGFGGG-RPAVGGS 124 Score = 51.2 bits (117), Expect = 2e-06 Identities = 31/73 (42%), Positives = 31/73 (42%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG G PG GG G G G GGG G G G G GG G G G G GG Sbjct: 36 GGLGGRPGFGGGPGFGGGPGF-GGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGG 94 Query: 537 GXXPXXGGAXXGG 499 G P GG GG Sbjct: 95 G--PGFGGGFGGG 105 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/141 (26%), Positives = 39/141 (27%), Gaps = 1/141 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG-GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG GG GG G G G G GG G G G Sbjct: 21 GGNANANANANANAQGGLGGRPGFGGGPGFGGGPGFGGG---PGFGGRPGFGGGPGFGGG 77 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 G G G G G G GG GGPG GG G G GG Sbjct: 78 PGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSGFGGGRPAVGGSSAASASSSASASG 137 Query: 603 GXGGXXGXGXXXXGXGGAGXG 541 G G G +G G Sbjct: 138 GGRGGAGSASASSSANASGGG 158 Score = 44.4 bits (100), Expect = 2e-04 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 2/89 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G G G GG GGPG GG G G GGG G G G G G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGF-GGGPGFGGGFGGGPGFGGGSG 113 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G G A GG G Sbjct: 114 FGGGRPAVGGSSAASASSSASASGGGRGG 142 Score = 42.7 bits (96), Expect = 7e-04 Identities = 32/82 (39%), Positives = 32/82 (39%), Gaps = 2/82 (2%) Frame = -3 Query: 738 GXXGGXXG--GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG G G G GG G GG G G G G G G G GG G G Sbjct: 36 GGLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGG----PGFGGGPGFGGGQGFGGRPG 91 Query: 564 GXGGAGXGGGXXPXXGGAXXGG 499 GG G GGG GG GG Sbjct: 92 FGGGPGFGGG---FGGGPGFGG 110 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GG G GGG G G G G GG GGG G G G Sbjct: 63 GGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSGFGGG 117 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG----GGXGGXGGGXXXXXGXGXXXG 500 G GG G GG GGG G G G G G GG G GGG G G G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGFGGGSG 113 Score = 30.3 bits (65), Expect = 4.1 Identities = 28/103 (27%), Positives = 28/103 (27%), Gaps = 1/103 (0%) Frame = -2 Query: 847 GGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXX-GXXXXXXXXXXXXXXXXXXX 671 GG G GGG G G GG G G Sbjct: 45 GGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGG 104 Query: 670 XXGXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG G GG G GG A GGG GG G Sbjct: 105 GPGFGGGSGFGG---GRPAVGGSSAASASSSASASGGGRGGAG 144 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 52.4 bits (120), Expect = 9e-07 Identities = 39/142 (27%), Positives = 39/142 (27%), Gaps = 2/142 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPG--PPXXP 715 P P PP P P P P PP P P P PP PP PP P Sbjct: 15 PLPPPP-PGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPP 73 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPX 895 P P P P P PP P P Sbjct: 74 PLFQPLLKLPKAWDF-QLERLDSALDNPELPPDFQPELPELGQPEDPPEDQPPEPPPLFQ 132 Query: 896 PAXPPPPXXXXXPPXPPRPXPP 961 P PPP PP PP PP Sbjct: 133 PLEPPP--LFQPPPDPPDDQPP 152 Score = 47.2 bits (107), Expect = 3e-05 Identities = 38/154 (24%), Positives = 38/154 (24%), Gaps = 6/154 (3%) Frame = +1 Query: 514 PXXXXXPXPPP---PRPXXPPXPXPXPXPPX--PPXPXPXXXXXXXPPSPPRPXXPXXXX 678 P P PPP P P PP P P PP P P P Sbjct: 45 PPEDQPPDPPPLFQPPPEEPPDDQPPPPPPLFQPLLKLPKAWDFQLERLDSALDNPELPP 104 Query: 679 XXXXXXXXXXXXXXXPXPXPG-PPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPP 855 P P PP PPPP P PP P Sbjct: 105 DFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDP 164 Query: 856 XPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P PP P PP PP P P Sbjct: 165 PPEDQPPPPLEGQALIMTLLPPDPPEDQPPPPPP 198 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/96 (33%), Positives = 32/96 (33%), Gaps = 8/96 (8%) Frame = +2 Query: 500 PPXXAP--PXXGXXP-PPXPAPPXPXXXXPXPXXPP--XPXPXPXXXXXXPPXPP---PA 655 PP P P G PP PP P PP P P P PP PP P Sbjct: 103 PPDFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPP 162 Query: 656 XPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP PP G PP P P P Sbjct: 163 DPPPEDQPP-PPLEGQALIMTLLPPDPPEDQPPPPP 197 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PP P PP P PP P PP PP PPP P Sbjct: 116 PEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQP 170 Score = 41.1 bits (92), Expect = 0.002 Identities = 44/164 (26%), Positives = 44/164 (26%), Gaps = 10/164 (6%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX---PXPXPXXXXXXPPXPPPAXPX-- 664 PP PP PP PP P P P P PP P Sbjct: 54 PPLFQPPPE--EPPDDQPPPPPPLFQPLLKLPKAWDFQLERLDSALDNPELPPDFQPELP 111 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 P PP PP PP P P P P P Sbjct: 112 ELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPP------------------- 152 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXX-----PPXPPRPXPP 961 PP P PP P P P PPP PP PP PP Sbjct: 153 PPSPPLFHPPDPPPEDQP--PPPLEGQALIMTLLPPDPPEDQPP 194 Score = 40.3 bits (90), Expect = 0.004 Identities = 33/144 (22%), Positives = 34/144 (23%), Gaps = 8/144 (5%) Frame = +1 Query: 550 RPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXXXXPX 729 +P PP P P PP PP P PP P P Sbjct: 14 QPLPPPPPGDQP-PPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPP 72 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP--------PXPXXPPPPXPPXPPPXXX 885 P P PP P PP PP PPP Sbjct: 73 PPLFQPLLKLPKAWDFQLERLDSALDNPELPPDFQPELPELGQPEDPPEDQPPEPPPLFQ 132 Query: 886 XXXXXXXXXXXPXPPXPXPPAPXP 957 P PP PP P P Sbjct: 133 PLEPPPLFQPPPDPPDDQPPPPSP 156 Score = 40.3 bits (90), Expect = 0.004 Identities = 39/142 (27%), Positives = 39/142 (27%), Gaps = 1/142 (0%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX-PPPPGPPXXP 715 PP P P P PP P P PPP P P PPPP PP Sbjct: 103 PPDFQPELPELGQPED--PPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFH 160 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPX 895 P PP P P P PP P PP P P Sbjct: 161 PPDPPPEDQP---PPPLEGQALIMTLL----------------PPDPPEDQPPPPPPLLQ 201 Query: 896 PAXPPPPXXXXXPPXPPRPXPP 961 P P P RP P Sbjct: 202 PCG--LPWATMQPSTTSRPRRP 221 Score = 38.7 bits (86), Expect = 0.012 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPX-PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP P PPP PP P P P PP P PP PP Sbjct: 124 PPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPP--PPLEGQALIM 181 Query: 677 PPXPPPPGPPXXPPXXPPXXP 739 PP P PP P P Sbjct: 182 TLLPPDPPEDQPPPPPPLLQP 202 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPP------XPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PPP PP P P P PPP PP PP PP P Sbjct: 17 PPPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPP 73 Score = 32.7 bits (71), Expect = 0.77 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 4/109 (3%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXP--PXPPPPXXPXXXXXXXXXXXXXXX 710 P PP PPP P P P PPPP P P Sbjct: 46 PEDQPPDPPPL-FQPPPEEPPDDQPPPPPPLFQPLLKLPKAWDFQLERLDSALDNPELPP 104 Query: 711 XXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPP--XPPP 851 P P PP PPP PP PPP Sbjct: 105 DFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPP 153 Score = 32.7 bits (71), Expect = 0.77 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 7/70 (10%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP-----XXPPXPXPXPXPP--XPPXPXPXXXXXXX 636 P P P PP P P PP P P PP PP P P Sbjct: 104 PDFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPD 163 Query: 637 PPSPPRPXXP 666 PP +P P Sbjct: 164 PPPEDQPPPP 173 Score = 31.5 bits (68), Expect = 1.8 Identities = 25/105 (23%), Positives = 25/105 (23%), Gaps = 1/105 (0%) Frame = +3 Query: 540 PPXPPX-PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXPXXXXXXXXXXXXXXXXX 716 P PP P P P P PPP P PPP P Sbjct: 100 PELPPDFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLF 159 Query: 717 XXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXPPP 851 P PP P PPP PP P Sbjct: 160 HPPDPPPE--DQPPPPLEGQALIMTLLPPDPPEDQPPPPPPLLQP 202 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 3/66 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP---XPPXPXPXXXXXXXPPSP 648 P PP P PP P P P P P PP PP P Sbjct: 129 PLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEGQALIMTLLPPDP 188 Query: 649 PRPXXP 666 P P Sbjct: 189 PEDQPP 194 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXP-XAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PPP PPP A P P PP PP PPP P Sbjct: 152 PPPSPPLFHPPDPPPEDQPPPPLEGQALIMTLLP-----PDPPEDQPPPPPPLLQP 202 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 52.4 bits (120), Expect = 9e-07 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P P P P PP PP P P PP PPPPGPP P P Sbjct: 42 PNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGP 85 Score = 47.2 bits (107), Expect = 3e-05 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXP--XXXPPXPPPPGPPXXPPXXPPXXPXPXX 751 P P P P P P P PPP P P PP PPPGPP PP PP P Sbjct: 34 PEPYRNPNPNPVPD-----PTRPPPPPPSPPCGRPPPGSPPPGPP--PPGPPPGCPGGPG 86 Query: 752 XP 757 P Sbjct: 87 GP 88 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPX--PPPAPPPPXXXPPXPPPPXXP 665 P + P P P PPP P +P P PPP PPPP P P P P Sbjct: 36 PYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 41.1 bits (92), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P PPP PP PP P PP Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPP---GSPPPGPPPPGPP 78 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P P P P P P PP +PPP PP PPP P Sbjct: 30 PAQYPEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPP--GPPPPGPPPGCP 82 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP----PPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P P P P PP PP PPG P PP PP P P P Sbjct: 30 PAQYPEPYRNPNPNPVPDPTRPPPP--PPSPPCGRPPPGSP--PPGPPPPGPPPGCPGGP 85 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPP-PPXXXPPXPPPP 656 P P P+ P PP PP P P P P PP PP P P P Sbjct: 36 PYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P P P PPPP PP PP PP Sbjct: 34 PEPYRNPNPNPVPDPTRPPPP-----PPSPPCGRPP 64 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PPPP PP PP P PP P PP P Sbjct: 42 PNPVPDPTRPPPP-PPSPP-----CGRPPPGSPPPGPPPPGPPPGCP 82 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +1 Query: 814 PPPPPPXPXXPPPP--XPPXPPP 876 PPPPP P PPP PP PPP Sbjct: 52 PPPPPSPPCGRPPPGSPPPGPPP 74 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +1 Query: 814 PPPPPPXP--XXPPPPXPPXPPP 876 PPPPPP P PPP PP PP Sbjct: 51 PPPPPPSPPCGRPPPGSPPPGPP 73 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P P P PPP P PP P PP P P Sbjct: 34 PEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSP-PPGPPPPGPPP 79 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPP--PXXXXXPPXPPRPXPP 961 P P P P P P PPP P PP P P PP Sbjct: 34 PEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPP 73 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 532 PXPPPPRPXXPP------XPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P P P RP PP P P PP PP P P P P Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PP P P P PP P P P P Sbjct: 51 PPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXP-PPPXXXXXPPXP 943 PP P PP +P P P P PPP P P Sbjct: 55 PPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPP P P PPP PP P P P P P Sbjct: 63 PPPGSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQWQPRRPPP 108 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P PP P PP P PP P P P P P Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGP 85 Score = 29.1 bits (62), Expect = 9.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P P P P PPP P P P Sbjct: 53 PPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 >BT003322-1|AAO25082.1| 575|Drosophila melanogaster AT02511p protein. Length = 575 Score = 52.0 bits (119), Expect = 1e-06 Identities = 44/154 (28%), Positives = 45/154 (29%), Gaps = 1/154 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G G G G G G + G G G GG Sbjct: 92 GGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSS 151 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 GA G G G G G G PGGG G G GGG GG G Sbjct: 152 SYGAPGQGQGNGNG---GRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYG---AP 205 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXG-GAXXGG 499 GG G G G G G P GA GG Sbjct: 206 GGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 Score = 47.6 bits (108), Expect = 3e-05 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 3/90 (3%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGG-GXGG-XXXGXGXAGGGXGGXXXXXXG-XGXGXGG 592 G G G G G G PGGG G GG G GGG GG G G G GG Sbjct: 70 GQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGG 129 Query: 591 XXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G GG G GG G G Sbjct: 130 RPSDTYGAPGGGGNGNGGRPSSSYGAPGQG 159 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG----XXXXXXGXGXGXGGX 589 G G GG G PGGG G G GGG GG G G G GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGR 148 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GA GG Sbjct: 149 PSSSYGAPGQGQGNGNGGRSSSSYGAPGGG 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 42/152 (27%), Positives = 42/152 (27%), Gaps = 11/152 (7%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGA-GXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GGG G G G G G GG Sbjct: 109 GGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAPGQGQGNGNGGRS 168 Query: 780 XXXGAXGXGXXXGX-----GXXGGXXGGXX----GGPGGGGXGG-XXXGXGXAGGGXGGX 631 G G G GG GG G PGGG GG G GGG GG Sbjct: 169 SSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGR 228 Query: 630 XXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G G G G G G G G Sbjct: 229 PSDTYGAPGGGNGNGSGGRPSSSYGAPGQGQG 260 Score = 44.4 bits (100), Expect = 2e-04 Identities = 44/157 (28%), Positives = 44/157 (28%), Gaps = 12/157 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGX------GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXX 799 GG G GG GGG G G G GG G Sbjct: 93 GGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSS 152 Query: 798 XXXXXXXXXGAXGXGXXXGXGXXGGXXGGXX----GGPGGGGXGGXXXGXGXAGGG-XGG 634 G G GG GG G PGGG G G GGG GG Sbjct: 153 YGAPGQGQGNGNGGRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGG 212 Query: 633 XXXXXXG-XGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 G G G GG G GG G G G P Sbjct: 213 RPSSSYGAPGGGNGGRPSDTYGAPG-GGNGNGSGGRP 248 Score = 40.7 bits (91), Expect = 0.003 Identities = 41/151 (27%), Positives = 43/151 (28%), Gaps = 2/151 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GGG G + G G G Sbjct: 191 GGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSS 250 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG-XGXG 601 GA G G G GG G PG G +G G GG G G G Sbjct: 251 SYGAPGQGQ----GGFGGRPSDSYGAPGQNQKPSDSYGAPGSGNGNGGRPSSSYGAPGSG 306 Query: 600 XGGXXGXGXXXXGXG-GAGXGGGXXPXXGGA 511 GG G GAG GG P GGA Sbjct: 307 PGGRPSDSYGPPASGSGAGGAGGSGP--GGA 335 Score = 40.3 bits (90), Expect = 0.004 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG G PGGG G G G G G G G GG G Sbjct: 37 GQSGPGGRPSDSYGAPGGGNGGRPSDSYGAPGQGQG--------QGQGQGGYAGKPSDTY 88 Query: 564 GXGGAGXGGGXXPXXG-GAXXGG 499 G G G G G P GA GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGG 111 Score = 35.9 bits (79), Expect = 0.083 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGG 553 G G G G GG G G GGG G G GG G G G Sbjct: 65 GAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPG 124 Query: 552 AGXGGGXXPXXGGAXXGG 499 G GG G GG Sbjct: 125 GGNGGRPSDTYGAPGGGG 142 Score = 33.9 bits (74), Expect = 0.34 Identities = 32/154 (20%), Positives = 33/154 (21%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+G G GG G G G G GG G G GG Sbjct: 287 GSGNGNGGRPSSSYGAPGSGPGGRPSDSYGPPASGSGAGGAGGSGPGGADYDNDIVEYEA 346 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G G G G G G G G Sbjct: 347 DQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGG 406 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 G G G G G GG G G Sbjct: 407 QDLGPSGYSGGRPGGQDLGAGGYSNGKPGGQDLG 440 Score = 31.1 bits (67), Expect = 2.4 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG--GXXGXGXX 571 G G G GGPGG G G G G G G G G G Sbjct: 359 GDANDGSGPSGP-GGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGG 417 Query: 570 XXGXGGAGXGGGXXPXXGGAXXG 502 G G GG GG G Sbjct: 418 RPGGQDLGAGGYSNGKPGGQDLG 440 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG-XGGXGGG 536 G GG GG G G GG GA G G GG G G Sbjct: 442 GGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNG 485 Score = 29.1 bits (62), Expect = 9.5 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGGXXXXXGXGXXXG 500 G GGG G G GGG + G GGG GG G G G Sbjct: 188 GAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNG 243 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 52.0 bits (119), Expect = 1e-06 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP PP P P P P PP PP + P PP PPPP P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPV--VAPPPPPPPPPAAVP 394 Query: 716 PXXPPXXP 739 P PP P Sbjct: 395 PPPPPPMP 402 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PPP PPP P + PPP PPPP PP PPPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVS--APVVAPPPPPPPPPAAVPPPPPPP 400 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P A P P P P P PP PPP P P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVP 394 Query: 680 PXPPPPGP 703 P PPPP P Sbjct: 395 PPPPPPMP 402 Score = 46.8 bits (106), Expect = 4e-05 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +2 Query: 536 PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPPPG 700 PPP P P P PP P P P PPP P P P PPP Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVS 376 Query: 701 -----PPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P P P Sbjct: 377 APVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PP APP P P PP P P P PP P P P P Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 692 PPGPPXXPPXXP 727 P P Sbjct: 416 TQAARPAAPAAP 427 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P P PP P P P P A P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP AP P PPPP PP PP P P Sbjct: 369 APPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 11/83 (13%) Frame = +2 Query: 548 PAPPXPXXXXP-------XPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPP 694 P PP P P PP P P P PPP P P P PPP Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 PGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPP 397 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PP PP PP P PPP PPP P PPP P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP------APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P APP P P P P P P P P P Sbjct: 358 PPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 662 XPXXXPPXPPPPGP 703 P P P P Sbjct: 416 TQAARPAAPAAPDP 429 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPR-----PXXPPXPXPXPXPPXPPXPXP 615 PP P P PPP P PP P P PP PP P P Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPX--PPPPXXP 665 P P PP P P AP P P APPPP P PPPP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP 388 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P P PPPP P P P P PP P P P RP P Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAP 424 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP--------XPPXPXPXXXXXX 633 P PP P PP P PP P PP PP P P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 634 XPPSPPRP 657 PP PP P Sbjct: 395 PPPPPPMP 402 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 14/78 (17%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXP-----------XXXPPXPPPP---GPPXXP 715 P P P P PP PP P P PP PPP PP P Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 716 PXXPPXXPXPXXXPXPXA 769 P P P P P A Sbjct: 375 VSAPVVAPPPPPPPPPAA 392 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP PP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPP 395 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/115 (24%), Positives = 28/115 (24%), Gaps = 7/115 (6%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP P P PP P PP P P P P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPP--NRPPPISTAPPPPP 374 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPP-------PXXXXXPPXPPRPXP 958 PP P P P P P P P P P P P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAPAAPDP 429 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P A PPPP PP P PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPP----PPPAAVPPPP 397 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPP----SPPRPXXPXXXXX 681 P P PPP P PP PP P P +PP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 682 XXXXXXXXXXXXXXPXPXPGPP 747 P P P PP Sbjct: 369 APPPPPVSAPVVAPPPPPPPPP 390 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP-AXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P A PP PP P PP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 52.0 bits (119), Expect = 1e-06 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP PP P P P P PP PP + P PP PPPP P P Sbjct: 304 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPV--VAPPPPPPPPPAAVP 361 Query: 716 PXXPPXXP 739 P PP P Sbjct: 362 PPPPPPMP 369 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PPP PPP P + PPP PPPP PP PPPP Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVS--APVVAPPPPPPPPPAAVPPPPPPP 367 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P A P P P P P PP PPP P P P Sbjct: 304 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVP 361 Query: 680 PXPPPPGP 703 P PPPP P Sbjct: 362 PPPPPPMP 369 Score = 46.8 bits (106), Expect = 4e-05 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +2 Query: 536 PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPPPG 700 PPP P P P PP P P P PPP P P P PPP Sbjct: 284 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVS 343 Query: 701 -----PPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P P P Sbjct: 344 APVVAPPPPPPPPPAAVPPPPPPPMP 369 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PP APP P P PP P P P PP P P P P Sbjct: 323 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAP 382 Query: 692 PPGPPXXPPXXP 727 P P Sbjct: 383 TQAARPAAPAAP 394 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P P PP P P P P A P Sbjct: 276 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 335 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP AP P PPPP PP PP P P Sbjct: 336 APPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 369 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 11/83 (13%) Frame = +2 Query: 548 PAPPXPXXXXP-------XPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPP 694 P PP P P PP P P P PPP P P P PPP Sbjct: 282 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 341 Query: 695 PGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P P P Sbjct: 342 VSAPVVAPPPPPPPPPAAVPPPP 364 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PP PP PP P PPP PPP P PPP P Sbjct: 288 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 345 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP------APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P APP P P P P P P P P P Sbjct: 325 PPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVPPPPPPPMPVGEIPVITTTHAP 382 Query: 662 XPXXXPPXPPPPGP 703 P P P P Sbjct: 383 TQAARPAAPAAPDP 396 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPR-----PXXPPXPXPXPXPPXPPXPXP 615 PP P P PPP P PP P P PP PP P P Sbjct: 326 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 369 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPX--PPPPXXP 665 P P PP P P AP P P APPPP P PPPP P Sbjct: 302 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP 355 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P P PPPP P P P P PP P P P RP P Sbjct: 337 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAP 391 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP--------XPPXPXPXXXXXX 633 P PP P PP P PP P PP PP P P Sbjct: 302 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 361 Query: 634 XPPSPPRP 657 PP PP P Sbjct: 362 PPPPPPMP 369 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 14/78 (17%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXP-----------XXXPPXPPPP---GPPXXP 715 P P P P PP PP P P PP PPP PP P Sbjct: 282 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 341 Query: 716 PXXPPXXPXPXXXPXPXA 769 P P P P P A Sbjct: 342 VSAPVVAPPPPPPPPPAA 359 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP PP Sbjct: 324 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPP 362 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/115 (24%), Positives = 28/115 (24%), Gaps = 7/115 (6%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP P P PP P PP P P P P Sbjct: 284 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPP--NRPPPISTAPPPPP 341 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPP-------PXXXXXPPXPPRPXP 958 PP P P P P P P P P P P P P P Sbjct: 342 VSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAPAAPDP 396 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P A PPPP PP P PP Sbjct: 330 PPPISTAPPPPPVSAPVVAPPPPPP----PPPAAVPPPP 364 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPP----SPPRPXXPXXXXX 681 P P PPP P PP PP P P +PP P P Sbjct: 276 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 335 Query: 682 XXXXXXXXXXXXXXPXPXPGPP 747 P P P PP Sbjct: 336 APPPPPVSAPVVAPPPPPPPPP 357 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP-AXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P A PP PP P PP Sbjct: 301 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 340 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 52.0 bits (119), Expect = 1e-06 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP PP P P P P PP PP + P PP PPPP P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPV--VAPPPPPPPPPAAVP 394 Query: 716 PXXPPXXP 739 P PP P Sbjct: 395 PPPPPPMP 402 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PPP PPP P + PPP PPPP PP PPPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVS--APVVAPPPPPPPPPAAVPPPPPPP 400 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P A P P P P P PP PPP P P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVP 394 Query: 680 PXPPPPGP 703 P PPPP P Sbjct: 395 PPPPPPMP 402 Score = 46.8 bits (106), Expect = 4e-05 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +2 Query: 536 PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPPPG 700 PPP P P P PP P P P PPP P P P PPP Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVS 376 Query: 701 -----PPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P P P Sbjct: 377 APVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PP APP P P PP P P P PP P P P P Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 692 PPGPPXXPPXXP 727 P P Sbjct: 416 TQAARPAAPAAP 427 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P P PP P P P P A P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP AP P PPPP PP PP P P Sbjct: 369 APPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 11/83 (13%) Frame = +2 Query: 548 PAPPXPXXXXP-------XPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPP 694 P PP P P PP P P P PPP P P P PPP Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 PGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPP 397 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PP PP PP P PPP PPP P PPP P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP------APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P APP P P P P P P P P P Sbjct: 358 PPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 662 XPXXXPPXPPPPGP 703 P P P P Sbjct: 416 TQAARPAAPAAPDP 429 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPR-----PXXPPXPXPXPXPPXPPXPXP 615 PP P P PPP P PP P P PP PP P P Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPX--PPPPXXP 665 P P PP P P AP P P APPPP P PPPP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP 388 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P P PPPP P P P P PP P P P RP P Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAP 424 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP--------XPPXPXPXXXXXX 633 P PP P PP P PP P PP PP P P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 634 XPPSPPRP 657 PP PP P Sbjct: 395 PPPPPPMP 402 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 14/78 (17%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXP-----------XXXPPXPPPP---GPPXXP 715 P P P P PP PP P P PP PPP PP P Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 716 PXXPPXXPXPXXXPXPXA 769 P P P P P A Sbjct: 375 VSAPVVAPPPPPPPPPAA 392 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP PP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPP 395 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/115 (24%), Positives = 28/115 (24%), Gaps = 7/115 (6%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP P P PP P PP P P P P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPP--NRPPPISTAPPPPP 374 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPP-------PXXXXXPPXPPRPXP 958 PP P P P P P P P P P P P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAPAAPDP 429 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P A PPPP PP P PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPP----PPPAAVPPPP 397 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPP----SPPRPXXPXXXXX 681 P P PPP P PP PP P P +PP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 682 XXXXXXXXXXXXXXPXPXPGPP 747 P P P PP Sbjct: 369 APPPPPVSAPVVAPPPPPPPPP 390 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP-AXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P A PP PP P PP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 52.0 bits (119), Expect = 1e-06 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP PP P P P P PP PP + P PP PPPP P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPV--VAPPPPPPPPPAAVP 394 Query: 716 PXXPPXXP 739 P PP P Sbjct: 395 PPPPPPMP 402 Score = 50.0 bits (114), Expect = 5e-06 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PPP PPP P + PPP PPPP PP PPPP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVS--APVVAPPPPPPPPPAAVPPPPPPP 400 Score = 48.8 bits (111), Expect = 1e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P A P P P P P PP PPP P P P Sbjct: 337 PPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVP 394 Query: 680 PXPPPPGP 703 P PPPP P Sbjct: 395 PPPPPPMP 402 Score = 46.8 bits (106), Expect = 4e-05 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +2 Query: 536 PPPXPAP-PXPXXXXPXPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPPPG 700 PPP P P P PP P P P PPP P P P PPP Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVS 376 Query: 701 -----PPXXPPXXPPXXPXPXXXPXP 763 PP PP P P P P P Sbjct: 377 APVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 46.0 bits (104), Expect = 8e-05 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 APP PP APP P P PP P P P PP P P P P Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 692 PPGPPXXPPXXP 727 P P Sbjct: 416 TQAARPAAPAAP 427 Score = 44.4 bits (100), Expect = 2e-04 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P P PP P P P P A P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP AP P PPPP PP PP P P Sbjct: 369 APPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 11/83 (13%) Frame = +2 Query: 548 PAPPXPXXXXP-------XPXXPPXPXPXPXXXXXXP----PXPPPAXPXPXXXPPXPPP 694 P PP P P PP P P P PPP P P P PPP Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 695 PGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPP 397 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PP PP PP P PPP PPP P PPP P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP------APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P APP P P P P P P P P P Sbjct: 358 PPPNRPPPISTAPPPPPVSAPVVAPPPPPP--PPPAAVPPPPPPPMPVGEIPVITTTHAP 415 Query: 662 XPXXXPPXPPPPGP 703 P P P P Sbjct: 416 TQAARPAAPAAPDP 429 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPR-----PXXPPXPXPXPXPPXPPXPXP 615 PP P P PPP P PP P P PP PP P P Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXP-PPAPPPPXXXPPX--PPPPXXP 665 P P PP P P AP P P APPPP P PPPP P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP 388 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P P PPPP P P P P PP P P P RP P Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAP 424 Score = 35.9 bits (79), Expect = 0.083 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 8/68 (11%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP--------XPPXPXPXXXXXX 633 P PP P PP P PP P PP PP P P Sbjct: 335 PLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVP 394 Query: 634 XPPSPPRP 657 PP PP P Sbjct: 395 PPPPPPMP 402 Score = 33.9 bits (74), Expect = 0.34 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 14/78 (17%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXP-----------XXXPPXPPPP---GPPXXP 715 P P P P PP PP P P PP PPP PP P Sbjct: 315 PMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 Query: 716 PXXPPXXPXPXXXPXPXA 769 P P P P P A Sbjct: 375 VSAPVVAPPPPPPPPPAA 392 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P AP P P P PP PP PP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPP 395 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/115 (24%), Positives = 28/115 (24%), Gaps = 7/115 (6%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP P P PP P PP P P P P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPP--NRPPPISTAPPPPP 374 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPP-------PXXXXXPPXPPRPXP 958 PP P P P P P P P P P P P P P Sbjct: 375 VSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAPTQAARPAAPAAPDP 429 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP PP P P A PPPP PP P PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPP----PPPAAVPPPP 397 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPP----SPPRPXXPXXXXX 681 P P PPP P PP PP P P +PP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 682 XXXXXXXXXXXXXXPXPXPGPP 747 P P P PP Sbjct: 369 APPPPPVSAPVVAPPPPPPPPP 390 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXP-AXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P A PP PP P PP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 >AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA protein. Length = 171 Score = 52.0 bits (119), Expect = 1e-06 Identities = 40/127 (31%), Positives = 40/127 (31%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GGGG G G G G GG G G GG G G Sbjct: 49 GGGGGGGGGYGGGYGGGYGGGYGGGGYGGESTVKVIKVI-------------TDSGAGGG 95 Query: 735 XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GG GG GG GGG G G G GG G G GG G G G Sbjct: 96 YRGGYAGGYGGGYGGGYGGA--YGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSGSY 153 Query: 555 GAGXGGG 535 G GG Sbjct: 154 GGSYAGG 160 Score = 44.0 bits (99), Expect = 3e-04 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGX--GXXXXGXGG 553 G GG GG GGG GG G G GGG GG G G G G GG Sbjct: 49 GGGGGGGGGYGGGYGGGY--GGGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGG 106 Query: 552 AGXGGGXXPXXGGAXXGG 499 G GGG GG GG Sbjct: 107 -GYGGGYGGAYGGGYGGG 123 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG GG GG GG G GGG GG Sbjct: 65 GYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYGGGYGG 114 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GGGG GGG G G G G GG GG Sbjct: 49 GGGGGGGGGYGGGYGGGYGGGYGGGGYGG 77 Score = 33.9 bits (74), Expect = 0.34 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G G G GG GG G GGG GG Sbjct: 63 GGGYG-GGYGGGGYGGESTVKVIKVITDSGAG-GGYRGGYAGGYGGGYGG 110 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 622 GGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GGG G G G GGG GG G G Sbjct: 49 GGGGGGGGGYGGGYGG-GYGGGYGGGGYG 76 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -2 Query: 652 GGGXGGXXXG--GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGG GG G GGG GGG G G GG GG G Sbjct: 105 GGGYGGGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSG 151 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G G G GG GGG G GG Sbjct: 107 GYGGGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSGSYGG 155 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 8/51 (15%) Frame = -2 Query: 664 GXXGGGGXGGXXX-------GGGGAGGGXGXXXXXG-AXGXGGGXGGXGGG 536 G GGGG GG GAGGG G G GGG GG GG Sbjct: 68 GGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYGGGYGGAYGG 118 >AE013599-2343|AAS64829.1| 575|Drosophila melanogaster CG15920-PB, isoform B protein. Length = 575 Score = 52.0 bits (119), Expect = 1e-06 Identities = 44/154 (28%), Positives = 45/154 (29%), Gaps = 1/154 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G G G G G G + G G G GG Sbjct: 92 GGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSS 151 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 GA G G G G G G PGGG G G GGG GG G Sbjct: 152 SYGAPGQGQGNGNG---GRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYG---AP 205 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXG-GAXXGG 499 GG G G G G G P GA GG Sbjct: 206 GGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 Score = 47.6 bits (108), Expect = 3e-05 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 3/90 (3%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGG-GXGG-XXXGXGXAGGGXGGXXXXXXG-XGXGXGG 592 G G G G G G PGGG G GG G GGG GG G G G GG Sbjct: 70 GQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGG 129 Query: 591 XXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G GG G GG G G Sbjct: 130 RPSDTYGAPGGGGNGNGGRPSSSYGAPGQG 159 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG----XXXXXXGXGXGXGGX 589 G G GG G PGGG G G GGG GG G G G GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGR 148 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GA GG Sbjct: 149 PSSSYGAPGQGQGNGNGGRSSSSYGAPGGG 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 42/152 (27%), Positives = 42/152 (27%), Gaps = 11/152 (7%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGA-GXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GGG G G G G G GG Sbjct: 109 GGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAPGQGQGNGNGGRS 168 Query: 780 XXXGAXGXGXXXGX-----GXXGGXXGGXX----GGPGGGGXGG-XXXGXGXAGGGXGGX 631 G G G GG GG G PGGG GG G GGG GG Sbjct: 169 SSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGR 228 Query: 630 XXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G G G G G G G G Sbjct: 229 PSDTYGAPGGGNGNGSGGRPSSSYGAPGQGQG 260 Score = 44.4 bits (100), Expect = 2e-04 Identities = 44/157 (28%), Positives = 44/157 (28%), Gaps = 12/157 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGX------GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXX 799 GG G GG GGG G G G GG G Sbjct: 93 GGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSS 152 Query: 798 XXXXXXXXXGAXGXGXXXGXGXXGGXXGGXX----GGPGGGGXGGXXXGXGXAGGG-XGG 634 G G GG GG G PGGG G G GGG GG Sbjct: 153 YGAPGQGQGNGNGGRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGG 212 Query: 633 XXXXXXG-XGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 G G G GG G GG G G G P Sbjct: 213 RPSSSYGAPGGGNGGRPSDTYGAPG-GGNGNGSGGRP 248 Score = 40.7 bits (91), Expect = 0.003 Identities = 41/151 (27%), Positives = 43/151 (28%), Gaps = 2/151 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GGG G + G G G Sbjct: 191 GGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSS 250 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG-XGXG 601 GA G G G GG G PG G +G G GG G G G Sbjct: 251 SYGAPGQGQ----GGFGGRPSDSYGAPGQNQKPSDSYGAPGSGNGNGGRPSSSYGAPGSG 306 Query: 600 XGGXXGXGXXXXGXG-GAGXGGGXXPXXGGA 511 GG G GAG GG P GGA Sbjct: 307 PGGRPSDSYGPPASGSGAGGAGGSGP--GGA 335 Score = 40.3 bits (90), Expect = 0.004 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG G PGGG G G G G G G G GG G Sbjct: 37 GQSGPGGRPSDSYGAPGGGNGGRPSDSYGAPGQGQG--------QGQGQGGYAGKPSDTY 88 Query: 564 GXGGAGXGGGXXPXXG-GAXXGG 499 G G G G G P GA GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGG 111 Score = 35.9 bits (79), Expect = 0.083 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGG 553 G G G G GG G G GGG G G GG G G G Sbjct: 65 GAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPG 124 Query: 552 AGXGGGXXPXXGGAXXGG 499 G GG G GG Sbjct: 125 GGNGGRPSDTYGAPGGGG 142 Score = 33.9 bits (74), Expect = 0.34 Identities = 32/154 (20%), Positives = 33/154 (21%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G+G G GG G G G G GG G G GG Sbjct: 287 GSGNGNGGRPSSSYGAPGSGPGGRPSDSYGPPASGSGAGGAGGSGPGGADYDNDIVEYEA 346 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G G G G G G G G Sbjct: 347 DQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGG 406 Query: 602 GGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXG 501 G G G G G GG G G Sbjct: 407 QDLGPSGYSGGRPGGQDLGAGGYSNGKPGGQDLG 440 Score = 31.1 bits (67), Expect = 2.4 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG--GXXGXGXX 571 G G G GGPGG G G G G G G G G G Sbjct: 359 GDANDGSGPSGP-GGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGG 417 Query: 570 XXGXGGAGXGGGXXPXXGGAXXG 502 G G GG GG G Sbjct: 418 RPGGQDLGAGGYSNGKPGGQDLG 440 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG-XGGXGGG 536 G GG GG G G GG GA G G GG G G Sbjct: 442 GGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNG 485 Score = 29.1 bits (62), Expect = 9.5 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGGXXXXXGXGXXXG 500 G GGG G G GGG + G GGG GG G G G Sbjct: 188 GAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNG 243 >AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-PA, isoform A protein. Length = 620 Score = 52.0 bits (119), Expect = 1e-06 Identities = 44/154 (28%), Positives = 45/154 (29%), Gaps = 1/154 (0%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G G G G G G + G G G GG Sbjct: 92 GGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSS 151 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 GA G G G G G G PGGG G G GGG GG G Sbjct: 152 SYGAPGQGQGNGNG---GRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYG---AP 205 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXG-GAXXGG 499 GG G G G G G P GA GG Sbjct: 206 GGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 Score = 47.6 bits (108), Expect = 3e-05 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 3/90 (3%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGG-GXGG-XXXGXGXAGGGXGGXXXXXXG-XGXGXGG 592 G G G G G G PGGG G GG G GGG GG G G G GG Sbjct: 70 GQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGG 129 Query: 591 XXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G GG G GG G G Sbjct: 130 RPSDTYGAPGGGGNGNGGRPSSSYGAPGQG 159 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG----XXXXXXGXGXGXGGX 589 G G GG G PGGG G G GGG GG G G G GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGR 148 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG GA GG Sbjct: 149 PSSSYGAPGQGQGNGNGGRSSSSYGAPGGG 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 42/152 (27%), Positives = 42/152 (27%), Gaps = 11/152 (7%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGA-GXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G GG GGG G G G G G GG Sbjct: 109 GGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAPGQGQGNGNGGRS 168 Query: 780 XXXGAXGXGXXXGX-----GXXGGXXGGXX----GGPGGGGXGG-XXXGXGXAGGGXGGX 631 G G G GG GG G PGGG GG G GGG GG Sbjct: 169 SSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGR 228 Query: 630 XXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G G G G G G G G Sbjct: 229 PSDTYGAPGGGNGNGSGGRPSSSYGAPGQGQG 260 Score = 44.4 bits (100), Expect = 2e-04 Identities = 44/157 (28%), Positives = 44/157 (28%), Gaps = 12/157 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGX------GXGAGXGGXXGXGXGGXXXXXXXXXXXXXXX 799 GG G GG GGG G G G GG G Sbjct: 93 GGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSS 152 Query: 798 XXXXXXXXXGAXGXGXXXGXGXXGGXXGGXX----GGPGGGGXGGXXXGXGXAGGG-XGG 634 G G GG GG G PGGG G G GGG GG Sbjct: 153 YGAPGQGQGNGNGGRSSSSYGAPGGGNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGNNGG 212 Query: 633 XXXXXXG-XGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 G G G GG G GG G G G P Sbjct: 213 RPSSSYGAPGGGNGGRPSDTYGAPG-GGNGNGSGGRP 248 Score = 40.7 bits (91), Expect = 0.003 Identities = 41/151 (27%), Positives = 43/151 (28%), Gaps = 2/151 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG GGG G + G G G Sbjct: 191 GGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSS 250 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG-XGXG 601 GA G G G GG G PG G +G G GG G G G Sbjct: 251 SYGAPGQGQ----GGFGGRPSDSYGAPGQNQKPSDSYGAPGSGNGNGGRPSSSYGAPGSG 306 Query: 600 XGGXXGXGXXXXGXG-GAGXGGGXXPXXGGA 511 GG G GAG GG P GGA Sbjct: 307 PGGRPSDSYGPPASGSGAGGAGGSGP--GGA 335 Score = 40.3 bits (90), Expect = 0.004 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG G PGGG G G G G G G G GG G Sbjct: 37 GQSGPGGRPSDSYGAPGGGNGGRPSDSYGAPGQGQG--------QGQGQGGYAGKPSDTY 88 Query: 564 GXGGAGXGGGXXPXXG-GAXXGG 499 G G G G G P GA GG Sbjct: 89 GAPGGGNGNGGRPSSSYGAPGGG 111 Score = 35.9 bits (79), Expect = 0.083 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGX-GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGG 553 G G G G GG G G GGG G G GG G G G Sbjct: 65 GAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGGRPSDTYGAPG 124 Query: 552 AGXGGGXXPXXGGAXXGG 499 G GG G GG Sbjct: 125 GGNGGRPSDTYGAPGGGG 142 Score = 31.1 bits (67), Expect = 2.4 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG--GXXGXGXX 571 G G G GGPGG G G G G G G G G G Sbjct: 404 GDANDGSGPSGP-GGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGG 462 Query: 570 XXGXGGAGXGGGXXPXXGGAXXG 502 G G GG GG G Sbjct: 463 RPGGQDLGAGGYSNGKPGGQDLG 485 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGG-XGGXGGG 536 G GG GG G G GG GA G G GG G G Sbjct: 487 GGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNG 530 Score = 29.1 bits (62), Expect = 9.5 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGGXXXXXGXGXXXG 500 G GGG G G GGG + G GGG GG G G G Sbjct: 188 GAPGGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNG 243 >BT003778-1|AAO41459.1| 278|Drosophila melanogaster RE04224p protein. Length = 278 Score = 50.8 bits (116), Expect = 3e-06 Identities = 46/162 (28%), Positives = 46/162 (28%), Gaps = 9/162 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPX-PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXP 667 PP AP P PAP P P P P P P P P P P Sbjct: 27 PPAPAPVYQPAPAPVYQPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVK 86 Query: 668 XXXPPXPPP-PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP P P P P P P P P P Sbjct: 87 TYVPPAPISIPAPVYQPAPAPIRIPAPVYQPAP----APISIPAPAPIEIPAPAPVNTYI 142 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP-PXP---PRPXP 958 PP P P PAP P P P P P P P P P P Sbjct: 143 PPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPAP 184 Score = 46.8 bits (106), Expect = 4e-05 Identities = 39/144 (27%), Positives = 39/144 (27%), Gaps = 5/144 (3%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXPXXXPPXPPPPGPPXX 712 P PAP P P P P P P P PPA P P P P P Sbjct: 52 PAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKTYVPPA-PISIPAPVYQPAPAPIRI 110 Query: 713 PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXP 892 P P P P P P P P P PAP Sbjct: 111 PAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVY 170 Query: 893 XPAXPPP--PXXXXXPPXPPRPXP 958 PA P P P P P P Sbjct: 171 QPAPAPVVIPAPAPAPVVIPAPAP 194 Score = 46.4 bits (105), Expect = 6e-05 Identities = 40/157 (25%), Positives = 40/157 (25%), Gaps = 4/157 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P Sbjct: 48 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKTYVPPAPISIPAPVYQPAPAP 107 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P P P P P P P P P Sbjct: 108 IRIPAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPA 167 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXP-PXP---PRPXP 958 P P PAP PA P P P P P P P P Sbjct: 168 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAP 204 Score = 44.0 bits (99), Expect = 3e-04 Identities = 43/156 (27%), Positives = 43/156 (27%), Gaps = 15/156 (9%) Frame = +2 Query: 536 PPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX---PXPXXXPPXPP- 691 P P P PP P P P P P P P P P P P P P Sbjct: 80 PAPAPVKTYVPPAPISI-PAPVYQPAPAPIRIPAPVYQPAPAPISIPAPAPIEIPAPAPV 138 Query: 692 ----PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 PP P P P P P P P P P Sbjct: 139 NTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPA-------------PAPA 185 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXP---PRPXP 958 P P PAP P P P PP P P P P Sbjct: 186 PVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAP 221 Score = 44.0 bits (99), Expect = 3e-04 Identities = 33/135 (24%), Positives = 33/135 (24%), Gaps = 2/135 (1%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P PAP P P P P P P P P P P P P P P Sbjct: 113 PVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQP 172 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXP--APX 889 P P P P P P P P P P Sbjct: 173 APAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQPAPISIPA 232 Query: 890 PXPAXPPPPXXXXXP 934 P P P P P Sbjct: 233 PAPVYQPAPAPVYQP 247 Score = 43.6 bits (98), Expect = 4e-04 Identities = 34/138 (24%), Positives = 34/138 (24%), Gaps = 1/138 (0%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP-PXPPPPGPPXX 712 P PAP P P P P PP P P P P P P P Sbjct: 107 PIRIPAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAP 166 Query: 713 PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXP 892 P P P P P P PP P P P P Sbjct: 167 APVYQPA-PAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQP 225 Query: 893 XPAXPPPPXXXXXPPXPP 946 P P P P P Sbjct: 226 APISIPAPAPVYQPAPAP 243 Score = 40.7 bits (91), Expect = 0.003 Identities = 38/155 (24%), Positives = 39/155 (25%), Gaps = 7/155 (4%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP P P P P P P P P P PA P PP P P Sbjct: 90 PPAPISIPAPVYQPAPAPIRIPAPVYQPAPAPISIPAPAPIEIPAPA-PVNTYIPPAPAP 148 Query: 695 -----PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P P P P P P P P P Sbjct: 149 APVYQPAPAPIPVSIPA--PAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVK 206 Query: 860 PXXPPXPA--PXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P P P +P P Sbjct: 207 SYVPPAPISIPAPAPVYQPAPISIPAPAPVYQPAP 241 Score = 40.3 bits (90), Expect = 0.004 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP- 679 P AP P P PAP P P P P P P PA P P P Sbjct: 133 PAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPA-PAPVVIPA 191 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P P P P P Sbjct: 192 PAPAPVVIPAPAPVKSYVPPAPISIPAP 219 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 12/100 (12%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP---PXP---XXXXPXPXXPPXPXPXPXXXXXXPPXP---PP 652 PP AP P P P P P P P P P P P P P P P Sbjct: 143 PPAPAPAPV-YQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPA 201 Query: 653 AXPXPXXXPPXP---PPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P P P P P P Sbjct: 202 PAPVKSYVPPAPISIPAPAPVYQPAPISIPAPAPVYQPAP 241 Score = 33.9 bits (74), Expect = 0.34 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P Sbjct: 168 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQPAP 227 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P P P P Sbjct: 228 ISIPAPAPVYQPAPAPVYQP 247 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPA--PPPPXXXPPXPPPP 656 P P P+ P P P P AP P P P P P PP P Sbjct: 160 PVSIPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAP 213 >AE013599-2441|AAF57885.2| 278|Drosophila melanogaster CG10953-PA protein. Length = 278 Score = 50.8 bits (116), Expect = 3e-06 Identities = 46/162 (28%), Positives = 46/162 (28%), Gaps = 9/162 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPX-PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXP 667 PP AP P PAP P P P P P P P P P P Sbjct: 27 PPAPAPVYQPAPAPVYQPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVK 86 Query: 668 XXXPPXPPP-PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP P P P P P P P P P Sbjct: 87 TYVPPAPISIPAPVYQPAPAPIRIPAPVYQPAP----APISIPAPAPIEIPAPAPVNTYI 142 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP-PXP---PRPXP 958 PP P P PAP P P P P P P P P P P Sbjct: 143 PPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPAP 184 Score = 46.8 bits (106), Expect = 4e-05 Identities = 39/144 (27%), Positives = 39/144 (27%), Gaps = 5/144 (3%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXPXXXPPXPPPPGPPXX 712 P PAP P P P P P P P PPA P P P P P Sbjct: 52 PAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKTYVPPA-PISIPAPVYQPAPAPIRI 110 Query: 713 PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXP 892 P P P P P P P P P PAP Sbjct: 111 PAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVY 170 Query: 893 XPAXPPP--PXXXXXPPXPPRPXP 958 PA P P P P P P Sbjct: 171 QPAPAPVVIPAPAPAPVVIPAPAP 194 Score = 46.4 bits (105), Expect = 6e-05 Identities = 40/157 (25%), Positives = 40/157 (25%), Gaps = 4/157 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P Sbjct: 48 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKTYVPPAPISIPAPVYQPAPAP 107 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P P P P P P P P P Sbjct: 108 IRIPAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPA 167 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXP-PXP---PRPXP 958 P P PAP PA P P P P P P P P Sbjct: 168 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAP 204 Score = 44.0 bits (99), Expect = 3e-04 Identities = 43/156 (27%), Positives = 43/156 (27%), Gaps = 15/156 (9%) Frame = +2 Query: 536 PPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX---PXPXXXPPXPP- 691 P P P PP P P P P P P P P P P P P P Sbjct: 80 PAPAPVKTYVPPAPISI-PAPVYQPAPAPIRIPAPVYQPAPAPISIPAPAPIEIPAPAPV 138 Query: 692 ----PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 PP P P P P P P P P P Sbjct: 139 NTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPA-------------PAPA 185 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXP---PRPXP 958 P P PAP P P P PP P P P P Sbjct: 186 PVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAP 221 Score = 44.0 bits (99), Expect = 3e-04 Identities = 33/135 (24%), Positives = 33/135 (24%), Gaps = 2/135 (1%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P PAP P P P P P P P P P P P P P P Sbjct: 113 PVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQP 172 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXP--APX 889 P P P P P P P P P P Sbjct: 173 APAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQPAPISIPA 232 Query: 890 PXPAXPPPPXXXXXP 934 P P P P P Sbjct: 233 PAPVYQPAPAPVYQP 247 Score = 43.6 bits (98), Expect = 4e-04 Identities = 34/138 (24%), Positives = 34/138 (24%), Gaps = 1/138 (0%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP-PXPPPPGPPXX 712 P PAP P P P P PP P P P P P P P Sbjct: 107 PIRIPAPVYQPAPAPISIPAPAPIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAP 166 Query: 713 PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXP 892 P P P P P P PP P P P P Sbjct: 167 APVYQPA-PAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQP 225 Query: 893 XPAXPPPPXXXXXPPXPP 946 P P P P P Sbjct: 226 APISIPAPAPVYQPAPAP 243 Score = 40.7 bits (91), Expect = 0.003 Identities = 38/155 (24%), Positives = 39/155 (25%), Gaps = 7/155 (4%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP P P P P P P P P P PA P PP P P Sbjct: 90 PPAPISIPAPVYQPAPAPIRIPAPVYQPAPAPISIPAPAPIEIPAPA-PVNTYIPPAPAP 148 Query: 695 -----PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 P P P P P P P P P Sbjct: 149 APVYQPAPAPIPVSIPA--PAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVK 206 Query: 860 PXXPPXPA--PXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P P P +P P Sbjct: 207 SYVPPAPISIPAPAPVYQPAPISIPAPAPVYQPAP 241 Score = 40.3 bits (90), Expect = 0.004 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP- 679 P AP P P PAP P P P P P P PA P P P Sbjct: 133 PAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPA-PAPVVIPA 191 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P P P P P Sbjct: 192 PAPAPVVIPAPAPVKSYVPPAPISIPAP 219 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 12/100 (12%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP---PXP---XXXXPXPXXPPXPXPXPXXXXXXPPXP---PP 652 PP AP P P P P P P P P P P P P P P P Sbjct: 143 PPAPAPAPV-YQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPA 201 Query: 653 AXPXPXXXPPXP---PPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P P P P P P P Sbjct: 202 PAPVKSYVPPAPISIPAPAPVYQPAPISIPAPAPVYQPAP 241 Score = 33.9 bits (74), Expect = 0.34 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P P P P PAP P P P P P P P P P Sbjct: 168 PVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAPAPVYQPAP 227 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P P P P P P Sbjct: 228 ISIPAPAPVYQPAPAPVYQP 247 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPA--PPPPXXXPPXPPPP 656 P P P+ P P P P AP P P P P P PP P Sbjct: 160 PVSIPAPAPVYQPAPAPVVIPAPAPAPVVIPAPAPAPVVIPAPAPVKSYVPPAP 213 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 50.4 bits (115), Expect = 4e-06 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGX--GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGX 544 GG GG GGGG GG G G GGG GG G G G G G GG G Sbjct: 22 GGRRGGRGGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGG 81 Query: 543 GGGXXPXXG-GAXXGG 499 GG G G+ GG Sbjct: 82 FGGPGRFGGPGSFNGG 97 Score = 47.2 bits (107), Expect = 3e-05 Identities = 32/79 (40%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAG--GGXGGXXXXXXGXGXGXGGXXGXGXX 571 G G GG G GG GGGG GG G G G GG GG G G GG G G Sbjct: 29 GGGGGGGRSLGGFGGRGGGGFGGRG-GPGGTGGPGGFGGPGRFGGPGGLGGGGGFG-GPG 86 Query: 570 XXGXGGAGXGGGXXPXXGG 514 G G+ GG P G Sbjct: 87 RFGGPGSFNGGFGGPGGWG 105 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/65 (44%), Positives = 29/65 (44%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G GG GGGG G G GGG G G G G GG G G G GG Sbjct: 21 GGGRRGGRGGGGGGGRS--LGGFGGRGGGGFGGRGGPGGTG-GPGGFGGPG-RFGGPGGL 76 Query: 549 GXGGG 535 G GGG Sbjct: 77 GGGGG 81 Score = 45.6 bits (103), Expect = 1e-04 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG-GXXXXXXGXGXGXGGXX 586 G G G G G G GGPGG G G G G GGG G G G G GG Sbjct: 40 GFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGGFGGPGRFGGPGSFNGGFG 99 Query: 585 GXG 577 G G Sbjct: 100 GPG 102 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGG-GXGGXGGGXXXXXGXGXXXG 500 GGGG G GGGG G G G G GG G G GG G G G Sbjct: 20 GGGGRRGGRGGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGG 72 Score = 38.3 bits (85), Expect = 0.016 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 G G GG G GG G GGG GG GG G G GG GG Sbjct: 20 GGGGRRGGRGGGGGGGRSLGGFGGRG---GGGFGGRGGPGGTGGPGGFGGPGRFGGPGGL 76 Query: 782 XXXXXXXXXGXXGGPGXGXG 723 G GGPG G Sbjct: 77 GGGGGFGGPGRFGGPGSFNG 96 Score = 37.9 bits (84), Expect = 0.021 Identities = 35/102 (34%), Positives = 36/102 (35%), Gaps = 1/102 (0%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXG 769 +GG G GGGG G G G GG G G GG Sbjct: 19 QGGGGRRGGR-GGGGGGGRSLG-GFGGRGGGGFGGRGGPGGTGGPGGF------------ 64 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGG-GGXGGXXXGXGXAGG 646 G G G G GG GG GGPG GG G G G GG Sbjct: 65 -GGPGRFGGPGGLGG--GGGFGGPGRFGGPGSFNGGFGGPGG 103 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/75 (30%), Positives = 23/75 (30%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGGGGXGGXXXGGGGAGGGXGXXXX 584 G GG G G G GG G G G GG GG G Sbjct: 29 GGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGGFGGPGRF 88 Query: 583 XGAXGXGGGXGGXGG 539 G GG GG GG Sbjct: 89 GGPGSFNGGFGGPGG 103 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G GG G GGG G G G G G GG Sbjct: 48 GFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGGFGGPGRFGGPGSFNGG 97 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 50.0 bits (114), Expect = 5e-06 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGG---GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G GG GG GG G GG G G GG G G G G GG Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYS 83 Query: 585 GXGXXXXG-XGGAGXGGGXXPXXGGAXXGG 499 G G GG G GG GG GG Sbjct: 84 GGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG G GGGG GG G GGG G G G GG Sbjct: 53 GLGGGLGGGL-GGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYS 111 Query: 582 XG 577 G Sbjct: 112 GG 113 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G+ G G GG G GGG GG G GG G GGGGGG Sbjct: 30 GGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGG 81 Score = 42.7 bits (96), Expect = 7e-04 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGG--GGXGGXXXGGGGAGGGXGXX 590 G GG G G G GG GG GG GGGG GG G Sbjct: 27 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGY 86 Query: 589 XXXGAXGXGGGXGGXGG 539 G GGG G GG Sbjct: 87 SNGGGYSGGGGYSGGGG 103 Score = 38.3 bits (85), Expect = 0.016 Identities = 37/142 (26%), Positives = 37/142 (26%), Gaps = 2/142 (1%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGGXXXXXXXXXX 783 G G GG GG GGG GG GG G GG GGGG Sbjct: 28 GGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYS 87 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G GG G Sbjct: 88 NGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEGYSGGYSGAQSGGYS- 146 Query: 602 GGXGGXGXGXGXGGXXGRGGGG 537 GG G G GG G G Sbjct: 147 GGYSGAQSGGYSGGYSGAQSAG 168 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG GG G GG G GGGG G GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGG 813 G G G GG G GG G G GGG G GG GGGG Sbjct: 53 GLGGGLGG-GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGX--GXGGX-GXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGG 816 G G G GG G GG G GGG G GG G G GGGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 50.0 bits (114), Expect = 5e-06 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGG---GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G GG GG GG G GG G G GG G G G G GG Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYS 83 Query: 585 GXGXXXXG-XGGAGXGGGXXPXXGGAXXGG 499 G G GG G GG GG GG Sbjct: 84 GGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG G GGGG GG G GGG G G G GG Sbjct: 53 GLGGGLGGGL-GGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYS 111 Query: 582 XG 577 G Sbjct: 112 GG 113 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G+ G G GG G GGG GG G GG G GGGGGG Sbjct: 30 GGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGG 81 Score = 42.7 bits (96), Expect = 7e-04 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGG--GGXGGXXXGGGGAGGGXGXX 590 G GG G G G GG GG GG GGGG GG G Sbjct: 27 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGY 86 Query: 589 XXXGAXGXGGGXGGXGG 539 G GGG G GG Sbjct: 87 SNGGGYSGGGGYSGGGG 103 Score = 38.3 bits (85), Expect = 0.016 Identities = 37/142 (26%), Positives = 37/142 (26%), Gaps = 2/142 (1%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGGXXXXXXXXXX 783 G G GG GG GGG GG GG G GG GGGG Sbjct: 28 GGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYS 87 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G GG G Sbjct: 88 NGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEGYSGGYSGAQSGGYS- 146 Query: 602 GGXGGXGXGXGXGGXXGRGGGG 537 GG G G GG G G Sbjct: 147 GGYSGAQSGGYSGGYSGAQSAG 168 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG GG G GG G GGGG G GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGG 813 G G G GG G GG G G GGG G GG GGGG Sbjct: 53 GLGGGLGG-GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGX--GXGGX-GXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGG 816 G G G GG G GG G GGG G GG G G GGGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 50.0 bits (114), Expect = 5e-06 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 4/90 (4%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGG---GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXX 586 G G G GG GG GG G GG G G GG G G G G GG Sbjct: 81 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYS 140 Query: 585 GXGXXXXG-XGGAGXGGGXXPXXGGAXXGG 499 G G GG G GG GG GG Sbjct: 141 GGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 170 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G G GG GG G GGGG GG G GGG G G G GG Sbjct: 110 GLGGGLGGGL-GGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYS 168 Query: 582 XG 577 G Sbjct: 169 GG 170 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G+ G G GG G GGG GG G GG G GGGGGG Sbjct: 87 GGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGG 138 Score = 42.7 bits (96), Expect = 7e-04 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = -2 Query: 763 GXGGXXGXRXXGXXXXXXXXXXXXXXXXXXXXXGXXGG--GGXGGXXXGGGGAGGGXGXX 590 G GG G G G GG GG GG GGGG GG G Sbjct: 84 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGY 143 Query: 589 XXXGAXGXGGGXGGXGG 539 G GGG G GG Sbjct: 144 SNGGGYSGGGGYSGGGG 160 Score = 38.3 bits (85), Expect = 0.016 Identities = 37/142 (26%), Positives = 37/142 (26%), Gaps = 2/142 (1%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGGXXXXXXXXXX 783 G G GG GG GGG GG GG G GG GGGG Sbjct: 85 GGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYS 144 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGX 603 G GG G G G GG G Sbjct: 145 NGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEGYSGGYSGAQSGGYS- 203 Query: 602 GGXGGXGXGXGXGGXXGRGGGG 537 GG G G GG G G Sbjct: 204 GGYSGAQSGGYSGGYSGAQSAG 225 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG GG G GG G GGGG G GG GG Sbjct: 121 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 170 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGG 813 G G G GG G GG G G GGG G GG GGGG Sbjct: 110 GLGGGLGG-GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 160 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGX--GXGGX-GXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGG 816 G G G GG G GG G GGG G GG G G GGGG Sbjct: 114 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 166 >AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA protein. Length = 113 Score = 50.0 bits (114), Expect = 5e-06 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 5/76 (6%) Frame = -3 Query: 726 GXXGGXXGGPGG-GGXGGXXXGXGXAG----GGXGGXXXXXXGXGXGXGGXXGXGXXXXG 562 G GG G GG GG GG G G G GG G G G G GG G G G Sbjct: 23 GGQGGFGGQQGGFGGQGGFGGGPGFGGQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGG 82 Query: 561 XGGAGXGGGXXPXXGG 514 GG G GG GG Sbjct: 83 PGGFGGQGGFGGGQGG 98 Score = 49.2 bits (112), Expect = 8e-06 Identities = 31/71 (43%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGG-GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G G G GG G GG GG GG G G G GGG GG G G G GG G Sbjct: 33 GGFGGQGGFGGGPG--FGGQGGFGGGPGEYGGQGGFGGGPGG-YGGQGGFGGGPGGFGGQ 89 Query: 579 GXXXXGXGGAG 547 G G GG G Sbjct: 90 GGFGGGQGGFG 100 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G GG GGG G G G G GG GG GGG G G G Sbjct: 40 GFGGGPGFGGQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGGPGGFGGQGGFGG 94 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 6/61 (9%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXG------GXGGGXXXXXGXGXXX 503 G G GG GG G GG GG G G G GGG G G GGG G G Sbjct: 21 GPGGQGGFGGQQGGFGGQGGFGGGPGFGGQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFG 80 Query: 502 G 500 G Sbjct: 81 G 81 Score = 41.9 bits (94), Expect = 0.001 Identities = 31/74 (41%), Positives = 31/74 (41%), Gaps = 4/74 (5%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGG--GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G G G G GG GG GG GG GG GG G G GGG GG G G G Sbjct: 40 GFGGGPGFGGQGGFGGGPGEYGGQGGFGGGPGG-YGGQGGFGGGPGG----FGGQGGFGG 94 Query: 594 GXXGXGXXXXGXGG 553 G G G GG Sbjct: 95 GQGGFGEHHRHHGG 108 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXG-GGXGGXGGGXXXXXGXG 512 G G GG G G GG GGG G G G G GG GG GG G G Sbjct: 49 GQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGGPGGFGGQGGFGGGQGGFG 100 Score = 36.7 bits (81), Expect = 0.048 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRX-GGGXGGXGGGGXXGXGGGGGG 813 G G GG G GG G GGG GG GG G G G GG G Sbjct: 37 GQGGFGGGPGFGGQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGGPGGFG 87 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG--GXGGXGGG-----GXXGXGGGGGG 813 G G G GG G G G GG G GG GGG G G GGG GG Sbjct: 42 GGGPGFGGQGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGGPGGFGGQGGFGGGQGG 98 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 49.6 bits (113), Expect = 6e-06 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PP P PP P P P PPP PPPP PP PP P Sbjct: 94 PEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP--GPPPPPGP 143 Score = 42.7 bits (96), Expect = 7e-04 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX--PPPAXPXPXXXPPXPPPPGPPXXP 715 P P+ P P P PP PPP P PP PPPPGPP P Sbjct: 82 PKPSVQHHYYYPPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPP--P 139 Query: 716 PXXPPXXP 739 P P P Sbjct: 140 PPGPYYNP 147 Score = 40.7 bits (91), Expect = 0.003 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPP--PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP P P P PA P P P PPPP P PP PP P P P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPP--PGPPPPGPPPPPGPYYNP 147 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP +P P PA PPPP PP PP P PP Sbjct: 106 PPQWSPGP-PAYPPPPQRPWGPPPPPGPPPP 135 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPPP P PP P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +1 Query: 814 PPPP-----PPXPXXPPPPXPPXPP 873 PPPP PP P PPPP PP PP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP P P P P P PP PPP P P PPPPGP P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPP-PPPGPPPPG----PPPPPGPYYNP 147 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 817 PPPPPXPXXPPPPX---PPXPPP 876 PPPP P PPPP PP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPP 139 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P PP PP P Sbjct: 126 PPPPPGPPPPGPPPPPGP 143 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP 934 PP P PP P P P PPPP P Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPP PP P PPPP P P Sbjct: 128 PPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P PP P PPPP PP P P P P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP P P PPPP P P Sbjct: 127 PPPPGPPPPGPPPPPGPYYNP 147 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 814 PPPPPPXPXXP-PPPXPPXPPP 876 PP PP P P PP PP PPP Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPP 134 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP PP P P P P P PP P PP PP P P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPP-----PGPPPPGPPPPPGP 143 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P PP P PP P P P PP PP P P P Sbjct: 106 PPQWSPGPPAYPPPPQ------RPWGPPPP-PGP------PPPGPPPPPGPYYNP 147 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P P PPPP P PP P PP P PP P Sbjct: 107 PQWSPGPPAYPPPPQRPWGPP------------PPPGPPPPGPPPP 140 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 49.6 bits (113), Expect = 6e-06 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 8/78 (10%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP--------PAXPXPXXXPPXPP 691 P P P P P P P P P PP PP A P PP PP Sbjct: 115 PAPRPPAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPP 174 Query: 692 PPGPPXXPPXXPPXXPXP 745 PP PP P P P P Sbjct: 175 PPPPPPTAPPRPRPRPRP 192 Score = 43.6 bits (98), Expect = 4e-04 Identities = 36/146 (24%), Positives = 36/146 (24%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PP P PP P P P A PP P P Sbjct: 70 PPTTTTTTPPPPPPPAPIRIRKPIWHP----------FFSSGFLPGAFDVDYADPPAPRP 119 Query: 695 PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPP 874 P P P PP P P P P P P PP Sbjct: 120 PA-PAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPP 178 Query: 875 XPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P P P RP Sbjct: 179 PPTAPPRPRPRPRPRPQQPDPQQRRP 204 Score = 43.6 bits (98), Expect = 4e-04 Identities = 30/116 (25%), Positives = 31/116 (26%), Gaps = 1/116 (0%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P PPPP P P P P PP+P P Sbjct: 79 PPPPPPAPIRIRKPIWHPFFSSGFLPGAFDVDYADPPAPRPPAPAPPTTQPPRRVRPQVR 138 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXP-PXPPP 876 P PP PPPPPP P PP P P P P P Sbjct: 139 PRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRP 194 Score = 41.9 bits (94), Expect = 0.001 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP---PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P PP PP P P PPP PPPP PP P P P Sbjct: 135 PQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRP 192 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PPP P P AP P PP PPPP P Sbjct: 129 PPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAP 183 Score = 39.5 bits (88), Expect = 0.007 Identities = 36/140 (25%), Positives = 37/140 (26%), Gaps = 5/140 (3%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPAXPXPXXXPPXPPPPGPPXXPP 718 PP P P PP P P P P A PP P PP P P Sbjct: 70 PPTTTTTTPPP--PPPPAPIRIRKPIWHPFFSSGFLPGAFDVDYADPPAPRPPAPAP-PT 126 Query: 719 XXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXP 898 PP P P P P PP P P P P Sbjct: 127 TQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAA-------PAEPPPPPPPPPP 179 Query: 899 AXPPPPXXXXXPPXPPRPXP 958 PP P P +P P Sbjct: 180 PTAPPRPRPRPRPRPQQPDP 199 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP 641 P+ PPP PP PPP P P P P P P P Sbjct: 164 PAAPAEPPPPPPPPPPPTAPPRPRPRPRPRPQQPDPQQRRP 204 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P PP PPP P P P P P P P P P Sbjct: 167 PAEPPPPPPPPPPPTAPPRPRPRPRPRPQQPDPQQRRP 204 Score = 35.1 bits (77), Expect = 0.15 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 9/86 (10%) Frame = +1 Query: 730 PXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP---------PXPXXPPPPXPPXPPPXX 882 P P PP PPPPP P P P PP PPP Sbjct: 120 PAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPP 179 Query: 883 XXXXXXXXXXXXPXPPXPXPPAPXPA 960 P P P P PA Sbjct: 180 PTAPPRPRPRPRPRPQQPDPQQRRPA 205 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXP 610 A P PPP P PP P P P P P P Sbjct: 162 AQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRP 194 Score = 33.5 bits (73), Expect = 0.44 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 8/88 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPX--------PXPXXXXXXPPXPPPA 655 PP APP PP P P PP P PP PPP Sbjct: 119 PPAPAPPTT--QPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPP 176 Query: 656 XPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P P P P P P P Sbjct: 177 PPPPTAPPRPRPRPRPRPQQPDPQQRRP 204 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 544 PPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P PP P P P P P P P P RP Sbjct: 167 PAEPPPPPPPPPPPTAPPRPRPRPRPRPQQPDPQQRRP 204 Score = 32.7 bits (71), Expect = 0.77 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P PP P P P P PP P P P P Sbjct: 143 PTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRPQQPDP 199 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXP---PXPXPXPX-PPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP P P PPR P P P P PP PP P +P P P Sbjct: 114 PPAPRPPAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPP 173 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 49.6 bits (113), Expect = 6e-06 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGA--GGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG GGGG GGG G G G G GG GGG G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G GG GGGG G G G GGG G G G GG G G G G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGGG GGG G G G GGG G GGG G G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G GGG GG G G G GG G G GG G GGG GG G Sbjct: 24 GGGGGGGGYGGGGGG--GYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 42.3 bits (95), Expect = 0.001 Identities = 24/51 (47%), Positives = 25/51 (49%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 GG GG GG GGGG GG G G +G G GG G G G G G G Sbjct: 26 GGGGGGYGGG-GGGGYGG--GGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G GG GG GG GGG G G GGG GG G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG---GXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GG G GG GGGG GGG G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 GG GGGG GG G G GGG GG G G GG G G G GGG Sbjct: 25 GGGGGGGYGGG--GGGGYGGGGGGQS------GYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG G G GG G G GGG G Sbjct: 28 GGGGYGGGGGGG--YGGGGGGQSGYGGGGQKNGGGGHGGGGQG 68 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGP---GGGGXGGXXXGXGXAGGGXGG 634 G G G G GG G GG GGGG GG G G GGG G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG--GQGSYGGGSQG 76 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GGG GG G G G G G G G G GG GGG G GG Sbjct: 21 GLLGGGGGGGGY---GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGG 816 G GG GGGG G GGGGG Sbjct: 21 GLLGGGGGGGGYGGGGGGG 39 Score = 29.1 bits (62), Expect = 9.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 933 GXXXXXGGGGXAGXGXGAGXGGXXG--XGXGG 844 G GGGG G G G G GG G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGG 52 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 49.6 bits (113), Expect = 6e-06 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGA--GGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG GG GGGG GGG G G G G GG GGG G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 45.2 bits (102), Expect = 1e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G GG GGGG G G G GGG G G G GG G G G G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGGG GGG G G G GGG G GGG G G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G GGG GG G G G GG G G GG G GGG GG G Sbjct: 24 GGGGGGGGYGGGGGG--GYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 42.3 bits (95), Expect = 0.001 Identities = 24/51 (47%), Positives = 25/51 (49%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 GG GG GG GGGG GG G G +G G GG G G G G G G Sbjct: 26 GGGGGGYGGG-GGGGYGG--GGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 41.5 bits (93), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G GG GG GG GGG G G GGG GG G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGG---GXGGXGGGGXXGXGGGGGG 813 G G G GG G GG G GG G GG GGGG GGG G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 GG GGGG GG G G GGG GG G G GG G G G GGG Sbjct: 25 GGGGGGGYGGG--GGGGYGGGGGGQS------GYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G G GG GG G G GG G G GGG G Sbjct: 28 GGGGYGGGGGGG--YGGGGGGQSGYGGGGQKNGGGGHGGGGQG 68 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGP---GGGGXGGXXXGXGXAGGGXGG 634 G G G G GG G GG GGGG GG G G GGG G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG--GQGSYGGGSQG 76 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXG-GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GGG GG G G G G G G G G GG GGG G GG Sbjct: 21 GLLGGGGGGGGY---GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGG 816 G GG GGGG G GGGGG Sbjct: 21 GLLGGGGGGGGYGGGGGGG 39 Score = 29.1 bits (62), Expect = 9.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 933 GXXXXXGGGGXAGXGXGAGXGGXXG--XGXGG 844 G GGGG G G G G GG G G GG Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGG 52 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 49.6 bits (113), Expect = 6e-06 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PP P PP P P P PPP PPPP PP PP P Sbjct: 94 PEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP--GPPPPPGP 143 Score = 42.7 bits (96), Expect = 7e-04 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX--PPPAXPXPXXXPPXPPPPGPPXXP 715 P P+ P P P PP PPP P PP PPPPGPP P Sbjct: 82 PKPSVQHHYYYPPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPP--P 139 Query: 716 PXXPPXXP 739 P P P Sbjct: 140 PPGPYYNP 147 Score = 40.7 bits (91), Expect = 0.003 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPP--PAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP P P P PA P P P PPPP P PP PP P P P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPP--PGPPPPGPPPPPGPYYNP 147 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP +P P PA PPPP PP PP P PP Sbjct: 106 PPQWSPGP-PAYPPPPQRPWGPPPPPGPPPP 135 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPPP P PP P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +1 Query: 814 PPPP-----PPXPXXPPPPXPPXPP 873 PPPP PP P PPPP PP PP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PP P P P P P PP PPP P P PPPPGP P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPP-PPPGPPPPG----PPPPPGPYYNP 147 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 817 PPPPPXPXXPPPPX---PPXPPP 876 PPPP P PPPP PP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPPPGPPP 139 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P PP PP P Sbjct: 126 PPPPPGPPPPGPPPPPGP 143 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP 934 PP P PP P P P PPPP P Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPP PP P PPPP P P Sbjct: 128 PPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P PP P PPPP PP P P P P P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP P P PPPP P P Sbjct: 127 PPPPGPPPPGPPPPPGPYYNP 147 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 814 PPPPPPXPXXP-PPPXPPXPPP 876 PP PP P P PP PP PPP Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPP 134 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PP PP P P P P P PP P PP PP P P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPP-----PGPPPPGPPPPPGP 143 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P PP P PP P P P PP PP P P P Sbjct: 106 PPQWSPGPPAYPPPPQ------RPWGPPPP-PGP------PPPGPPPPPGPYYNP 147 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P P PPPP P PP P PP P PP P Sbjct: 107 PQWSPGPPAYPPPPQRPWGPP------------PPPGPPPPGPPPP 140 >BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p protein. Length = 157 Score = 49.2 bits (112), Expect = 8e-06 Identities = 34/92 (36%), Positives = 35/92 (38%), Gaps = 6/92 (6%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX-GGXXXXXXGXGX-----GXG 595 G G G GG G GGPGG G GG G G GG G G G G Sbjct: 25 GSRGGPGAGGGAPGAGGGGPGGRG-GGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPG 83 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G GG GG GG Sbjct: 84 GKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGG 115 Score = 48.0 bits (109), Expect = 2e-05 Identities = 32/93 (34%), Positives = 32/93 (34%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GG G G GAG GG G G G G G G G G Sbjct: 28 GGPGAGGGAPGAGGGGPGGRGGG----PPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPG 83 Query: 735 XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 GG GG G G GG GG G GGG G Sbjct: 84 GKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = -1 Query: 746 GGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGX 567 GGPG G G+GG GG G G GG G G G Sbjct: 42 GGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRNGPGGSGGP 101 Query: 566 GGXXGRGGGGXGXXXXXG 513 GG GGG G G Sbjct: 102 GGRNAPNGGGGGGGGPFG 119 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/145 (26%), Positives = 39/145 (26%), Gaps = 5/145 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXX---PPX--PXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 G PPP P P P PP P P PP PP PP P Sbjct: 525 GPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGP 584 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PPGPP P P P P P PP P Sbjct: 585 PPGPPGG-PARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPPQHNGNP 643 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPP 946 P + PPPP PP Sbjct: 644 GHPYAPEHGSNPPPPQQQQQQQPPP 668 Score = 46.0 bits (104), Expect = 8e-05 Identities = 40/158 (25%), Positives = 40/158 (25%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P A P PP P P P PPP P P Sbjct: 482 PTPTPPPE-VAPAAGAATAATTTTTTTPTPPPVPQQVPLPQQQGGPAPPPGMP-QMHPHP 539 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PPPG PP P P P P P P Sbjct: 540 GHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQP 599 Query: 863 XXPPXPAPXPXPAXPPPPXXXXXPP-----XPPRPXPP 961 P P P A P PP PRP PP Sbjct: 600 QYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPP 637 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/155 (24%), Positives = 38/155 (24%), Gaps = 9/155 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPX---PXXXXXXP---PXPPPAXPXPXXX 676 PP P PA P P P PP P P P P P PA Sbjct: 360 PPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETA 419 Query: 677 PPXPPPPGP--PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP- 847 P P P P PP P A P Sbjct: 420 SKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTLVEPPKTEPAKVVAQPGKVPT 479 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP AP A P PP P Sbjct: 480 PVPTPTPPPEVAPAAGAATAATTTTTTTPTPPPVP 514 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P A P P P P P P P P P P P PP Sbjct: 376 PASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETASKTDPE--PMDIEPPP 433 Query: 683 XPPPPGPPXXP 715 P P PP P Sbjct: 434 KPSVPPPPIKP 444 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG G GG GGGGGG Sbjct: 23 GGGGGSGGGSRSRSSGGGGGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP--PXPXAPXXXXXPXPPPA----PPPPXXXPPXPPP 653 P P P P P P P P P P PP PPP P PPP Sbjct: 514 PQQVPLPQQQGGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.2 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 10/87 (11%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPP----AXPXP 667 PP P P P PP P P P P P P P P Sbjct: 550 PPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQP 609 Query: 668 XXXPPXP------PPPGPPXXPPXXPP 730 P P PPPG P PP Sbjct: 610 YYAPFSPYQQSYGPPPGSHYMSPRPPP 636 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/145 (26%), Positives = 39/145 (26%), Gaps = 5/145 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXX---PPX--PXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 G PPP P P P PP P P PP PP PP P Sbjct: 233 GPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGP 292 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PPGPP P P P P P PP P Sbjct: 293 PPGPPGG-PARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPPQHNGNP 351 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPP 946 P + PPPP PP Sbjct: 352 GHPYAPEHGSNPPPPQQQQQQQPPP 376 Score = 46.0 bits (104), Expect = 8e-05 Identities = 40/158 (25%), Positives = 40/158 (25%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P A P PP P P P PPP P P Sbjct: 190 PTPTPPPE-VAPAAGAATAATTTTTTTPTPPPVPQQVPLPQQQGGPAPPPGMP-QMHPHP 247 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PPPG PP P P P P P P Sbjct: 248 GHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQP 307 Query: 863 XXPPXPAPXPXPAXPPPPXXXXXPP-----XPPRPXPP 961 P P P A P PP PRP PP Sbjct: 308 QYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPP 345 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/155 (24%), Positives = 38/155 (24%), Gaps = 9/155 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPX---PXXXXXXP---PXPPPAXPXPXXX 676 PP P PA P P P PP P P P P P PA Sbjct: 68 PPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETA 127 Query: 677 PPXPPPPGP--PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP- 847 P P P P PP P A P Sbjct: 128 SKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTLVEPPKTEPAKVVAQPGKVPT 187 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP AP A P PP P Sbjct: 188 PVPTPTPPPEVAPAAGAATAATTTTTTTPTPPPVP 222 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P A P P P P P P P P P P P PP Sbjct: 84 PASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETASKTDPE--PMDIEPPP 141 Query: 683 XPPPPGPPXXP 715 P P PP P Sbjct: 142 KPSVPPPPIKP 152 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP--PXPXAPXXXXXPXPPPA----PPPPXXXPPXPPP 653 P P P P P P P P P P PP PPP P PPP Sbjct: 222 PQQVPLPQQQGGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 278 Score = 29.5 bits (63), Expect = 7.2 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 10/87 (11%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPP----AXPXP 667 PP P P P PP P P P P P P P P Sbjct: 258 PPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQP 317 Query: 668 XXXPPXP------PPPGPPXXPPXXPP 730 P P PPPG P PP Sbjct: 318 YYAPFSPYQQSYGPPPGSHYMSPRPPP 344 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/145 (26%), Positives = 39/145 (26%), Gaps = 5/145 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXX---PPX--PXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 G PPP P P P PP P P PP PP PP P Sbjct: 525 GPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGP 584 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PPGPP P P P P P PP P Sbjct: 585 PPGPPGG-PARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPPQHNGNP 643 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPP 946 P + PPPP PP Sbjct: 644 GHPYAPEHGSNPPPPQQQQQQQPPP 668 Score = 46.0 bits (104), Expect = 8e-05 Identities = 40/158 (25%), Positives = 40/158 (25%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P A P PP P P P PPP P P Sbjct: 482 PTPTPPPE-VAPAAGAATAATTTTTTTPTPPPVPQQVPLPQQQGGPAPPPGMP-QMHPHP 539 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PPPG PP P P P P P P Sbjct: 540 GHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQP 599 Query: 863 XXPPXPAPXPXPAXPPPPXXXXXPP-----XPPRPXPP 961 P P P A P PP PRP PP Sbjct: 600 QYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPP 637 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/155 (24%), Positives = 38/155 (24%), Gaps = 9/155 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPX---PXXXXXXP---PXPPPAXPXPXXX 676 PP P PA P P P PP P P P P P PA Sbjct: 360 PPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETA 419 Query: 677 PPXPPPPGP--PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP- 847 P P P P PP P A P Sbjct: 420 SKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTLVEPPKTEPAKVVAQPGKVPT 479 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP AP A P PP P Sbjct: 480 PVPTPTPPPEVAPAAGAATAATTTTTTTPTPPPVP 514 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P A P P P P P P P P P P P PP Sbjct: 376 PASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETASKTDPE--PMDIEPPP 433 Query: 683 XPPPPGPPXXP 715 P P PP P Sbjct: 434 KPSVPPPPIKP 444 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG G GG GGGGGG Sbjct: 23 GGGGGSGGGSRSRSSGGGGGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP--PXPXAPXXXXXPXPPPA----PPPPXXXPPXPPP 653 P P P P P P P P P P PP PPP P PPP Sbjct: 514 PQQVPLPQQQGGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.2 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 10/87 (11%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPP----AXPXP 667 PP P P P PP P P P P P P P P Sbjct: 550 PPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQP 609 Query: 668 XXXPPXP------PPPGPPXXPPXXPP 730 P P PPPG P PP Sbjct: 610 YYAPFSPYQQSYGPPPGSHYMSPRPPP 636 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/145 (26%), Positives = 39/145 (26%), Gaps = 5/145 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXX---PPX--PXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 G PPP P P P PP P P PP PP PP P Sbjct: 525 GPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGP 584 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PPGPP P P P P P PP P Sbjct: 585 PPGPPGG-PARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPPQHNGNP 643 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPP 946 P + PPPP PP Sbjct: 644 GHPYAPEHGSNPPPPQQQQQQQPPP 668 Score = 45.6 bits (103), Expect = 1e-04 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 5/131 (3%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P P P PPP P P PPPG PP P P P P Sbjct: 508 PTPPPVPQQVPLPQQQGGPAPPPGMP-QMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLP 566 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPP-- 937 P P P P P A P PP Sbjct: 567 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 626 Query: 938 ---XPPRPXPP 961 PRP PP Sbjct: 627 SHYMSPRPPPP 637 Score = 37.1 bits (82), Expect = 0.036 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 6/82 (7%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP PPP P P PP P P P P P P Sbjct: 555 PHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPF 614 Query: 683 XP------PPPGPPXXPPXXPP 730 P PPPG P PP Sbjct: 615 SPYQQSYGPPPGSHYMSPRPPP 636 Score = 33.9 bits (74), Expect = 0.34 Identities = 37/155 (23%), Positives = 37/155 (23%), Gaps = 9/155 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPX---PXXXXXXP---PXPPPAXPXPXXX 676 PP P PA P P P PP P P P P P PA Sbjct: 360 PPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETA 419 Query: 677 PPXPPPPGP--PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP- 847 P P P P PP P A P Sbjct: 420 SKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTLVEPPKTEPAKVVAQPGKVPT 479 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP AP P PP P Sbjct: 480 PVPTPTPPPEVAPAAGAVTAATTTTRRTPTPPPVP 514 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P A P P P P P P P P P P P PP Sbjct: 376 PASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETASKTDPE--PMDIEPPP 433 Query: 683 XPPPPGPPXXP 715 P P PP P Sbjct: 434 KPSVPPPPIKP 444 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG G GG GGGGGG Sbjct: 23 GGGGGSGGGSRSRSSGGGGGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP--PXPXAPXXXXXPXPPPA----PPPPXXXPPXPPP 653 P P P P P P P P P P PP PPP P PPP Sbjct: 514 PQQVPLPQQQGGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 49.2 bits (112), Expect = 8e-06 Identities = 38/145 (26%), Positives = 39/145 (26%), Gaps = 5/145 (3%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXX---PPX--PXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 G PPP P P P PP P P PP PP PP P Sbjct: 525 GPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGP 584 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PPGPP P P P P P PP P Sbjct: 585 PPGPPGG-PARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPPQHNGNP 643 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPP 946 P + PPPP PP Sbjct: 644 GHPYAPEHGSNPPPPQQQQQQQPPP 668 Score = 46.0 bits (104), Expect = 8e-05 Identities = 40/158 (25%), Positives = 40/158 (25%), Gaps = 5/158 (3%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P A P PP P P P PPP P P Sbjct: 482 PTPTPPPE-VAPAAGAATAATTTTTTTPTPPPVPQQVPLPQQQGGPAPPPGMP-QMHPHP 539 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PPPG PP P P P P P P Sbjct: 540 GHPPPGHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQP 599 Query: 863 XXPPXPAPXPXPAXPPPPXXXXXPP-----XPPRPXPP 961 P P P A P PP PRP PP Sbjct: 600 QYGGHPTPQPYYAPFSPYQQSYGPPPGSHYMSPRPPPP 637 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/155 (24%), Positives = 38/155 (24%), Gaps = 9/155 (5%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPX---PXXXXXXP---PXPPPAXPXPXXX 676 PP P PA P P P PP P P P P P PA Sbjct: 360 PPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETA 419 Query: 677 PPXPPPPGP--PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP- 847 P P P P PP P A P Sbjct: 420 SKTDPEPMDIEPPPKPSVPPPPIKPEKLEMAAALPPQSTLVEPPKTEPAKVVAQPGKVPT 479 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP AP A P PP P Sbjct: 480 PVPTPTPPPEVAPAAGAATAATTTTTTTPTPPPVP 514 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P A P P P P P P P P P P P PP Sbjct: 376 PASAVPAPAAPPKETPPAVKPATLNPTPSSTPTPAPAVHVHETASKTDPE--PMDIEPPP 433 Query: 683 XPPPPGPPXXP 715 P P PP P Sbjct: 434 KPSVPPPPIKP 444 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG G GG GGGGGG Sbjct: 23 GGGGGSGGGSRSRSSGGGGGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPP--PXPXAPXXXXXPXPPPA----PPPPXXXPPXPPP 653 P P P P P P P P P P PP PPP P PPP Sbjct: 514 PQQVPLPQQQGGPAPPPGMPQMHPHPGHPPPGHSLMPPHMGPHQPPPGMPGLPPPPP 570 Score = 29.5 bits (63), Expect = 7.2 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 10/87 (11%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPP----AXPXP 667 PP P P P PP P P P P P P P P Sbjct: 550 PPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQP 609 Query: 668 XXXPPXP------PPPGPPXXPPXXPP 730 P P PPPG P PP Sbjct: 610 YYAPFSPYQQSYGPPPGSHYMSPRPPP 636 >AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-PA protein. Length = 157 Score = 49.2 bits (112), Expect = 8e-06 Identities = 34/92 (36%), Positives = 35/92 (38%), Gaps = 6/92 (6%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGX-GGXXXXXXGXGX-----GXG 595 G G G GG G GGPGG G GG G G GG G G G G Sbjct: 25 GSRGGPGAGGGAPGAGGGGPGGRG-GGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPG 83 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG+G GG GG GG Sbjct: 84 GKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGG 115 Score = 48.0 bits (109), Expect = 2e-05 Identities = 32/93 (34%), Positives = 32/93 (34%) Frame = -3 Query: 915 GGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXG 736 GG G G GAG GG G G G G G G G G Sbjct: 28 GGPGAGGGAPGAGGGGPGGRGGG----PPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPG 83 Query: 735 XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 GG GG G G GG GG G GGG G Sbjct: 84 GKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = -1 Query: 746 GGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGX 567 GGPG G G+GG GG G G GG G G G Sbjct: 42 GGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRNGPGGSGGP 101 Query: 566 GGXXGRGGGGXGXXXXXG 513 GG GGG G G Sbjct: 102 GGRNAPNGGGGGGGGPFG 119 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 48.8 bits (111), Expect = 1e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX-PXPXXXPPXPPPPGPPXXPP 718 P P+ P P P P PP P P P P P P P PP PPP PP P Sbjct: 45 PTPSAPAPP---PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Query: 719 XXP 727 P Sbjct: 102 ATP 104 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPP----PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PPP PP PP P P P P PPPP P PP P P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP---XXXXXXPPXPPPAXPXPXX 673 P P PPP P PP P P PP P P PP PPP+ P Sbjct: 41 PDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP---- 96 Query: 674 XPPXPPPPG 700 PP P PG Sbjct: 97 PPPDPATPG 105 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 557 PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXX 736 P P P P P P P P PP P P P PPP PP PP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPT-PTTTPTPITTPPPPPPSAPPPPDPAT 103 Query: 737 P 739 P Sbjct: 104 P 104 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP---PPPXXXPPXPPPPXXP 665 P P PS PP P PPP P P P P P P P PP PPP P Sbjct: 41 PDNFPTPSAPAPPPKPRP-PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP PPP P P P P P PP PP P P P Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP-XPPAPXPA 960 PP P P P PPPP PP P PP P PP P PA Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPA 102 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSPPR 654 P P P P PPPP P P P P P P P PPS P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Query: 655 PXXP 666 P P Sbjct: 98 PPDP 101 Score = 39.5 bits (88), Expect = 0.007 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P+ P P P PPPP PP P P P P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTP 84 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP----PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PPP PP PP P PP P P AP P Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP---XXPPXXPXPXXXPXP 763 P P P PA P PP PPPP PP P P P P P Sbjct: 34 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPP--XXXPPXPPP 653 P P P P AP P PPP PPPP PP P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTP 76 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P PP PPPP P PPPP P P Sbjct: 56 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXP-PXPXPPAPXPA 960 P P P P P P PP PPP P P PP P P+ Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPS 94 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 570 PXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P PP P PP PPPP Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPP 66 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPX--PXPXXXXXXXPPSPPRP 657 PP P P PPPP PP P P P P P PP P P Sbjct: 53 PPKPRPPP---PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPX----PAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P P PPP PP PP P P Sbjct: 63 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP-PPDPATP 104 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P PP P P P P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVWYPLPIYGNAP 117 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXP 757 PPG P P P Sbjct: 118 QFGDPPGSHLLSNSGKPHPPGSQMPP 143 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P+ P PP PP PP P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPP 65 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPP 873 P P P PP PPPPPP PPP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDPATP 104 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 48.8 bits (111), Expect = 1e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX-PXPXXXPPXPPPPGPPXXPP 718 P P+ P P P P PP P P P P P P P PP PPP PP P Sbjct: 45 PTPSAPAPP---PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Query: 719 XXP 727 P Sbjct: 102 ATP 104 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPP----PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PPP PP PP P P P P PPPP P PP P P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP---XXXXXXPPXPPPAXPXPXX 673 P P PPP P PP P P PP P P PP PPP+ P Sbjct: 41 PDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP---- 96 Query: 674 XPPXPPPPG 700 PP P PG Sbjct: 97 PPPDPATPG 105 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 557 PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXX 736 P P P P P P P P PP P P P PPP PP PP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPT-PTTTPTPITTPPPPPPSAPPPPDPAT 103 Query: 737 P 739 P Sbjct: 104 P 104 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP---PPPXXXPPXPPPPXXP 665 P P PS PP P PPP P P P P P P P PP PPP P Sbjct: 41 PDNFPTPSAPAPPPKPRP-PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP PPP P P P P P PP PP P P P Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP-XPPAPXPA 960 PP P P P PPPP PP P PP P PP P PA Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPA 102 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSPPR 654 P P P P PPPP P P P P P P P PPS P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Query: 655 PXXP 666 P P Sbjct: 98 PPDP 101 Score = 39.5 bits (88), Expect = 0.007 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P+ P P P PPPP PP P P P P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTP 84 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP----PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PPP PP PP P PP P P AP P Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP---XXPPXXPXPXXXPXP 763 P P P PA P PP PPPP PP P P P P P Sbjct: 34 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPP--XXXPPXPPP 653 P P P P AP P PPP PPPP PP P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTP 76 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P PP PPPP P PPPP P P Sbjct: 56 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXP-PXPXPPAPXPA 960 P P P P P P PP PPP P P PP P P+ Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPS 94 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 570 PXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P PP P PP PPPP Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPPP 66 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPX--PXPXXXXXXXPPSPPRP 657 PP P P PPPP PP P P P P P PP P P Sbjct: 53 PPKPRPPP---PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPX----PAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P P PPP PP PP P P Sbjct: 63 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP-PPDPATP 104 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P PP P P P P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVWYPLPIYGNAP 117 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXP 757 PPG P P P Sbjct: 118 QFGDPPGSHLLSNSGKPHPPGSQMPP 143 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P+ P PP PP PP P Sbjct: 38 PYVPDNFPTPSAPAPPPKPRPPPPPPPP 65 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPP 873 P P P PP PPPPPP PPP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDPATP 104 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 48.8 bits (111), Expect = 1e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PP P PP P P P PPP PPPP PP PP P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP--GPPPPPGP 113 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPX--PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P PP PPP P PP PPPPGPP PP P P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPP--PPPGPYYNP 117 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP +P P PA PPPP PP PP P PP Sbjct: 76 PPQWSPGP-PAYPPPPQRPWGPPPPPGPPPP 105 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 647 PPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PPA P P P PPPP P PP PP P P P Sbjct: 83 PPAYPPPPQRPWGPPPP--PGPPPPGPPPPPGPYYNP 117 Score = 38.3 bits (85), Expect = 0.016 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP P P PP P P P PP PP P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPPP P PP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPX-P-XPXPPXPPXP 609 PP P P PPP RP PP P P P PP PP P Sbjct: 76 PPQWSPGPPAYP-PPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +1 Query: 814 PPPP-----PPXPXXPPPPXPPXPP 873 PPPP PP P PPPP PP PP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP 616 PP PP P PP P P PP P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 817 PPPPPXPXXPPPPX---PPXPPP 876 PPPP P PPPP PP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPP 109 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P PP PP P Sbjct: 96 PPPPPGPPPPGPPPPPGP 113 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 PP P P P P P P PP PPPP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP 934 PP P PP P P P PPPP P Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P P P P PPP P P P PPPPGP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPP---PGPPPPPGPYYNP 117 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPP PP P PPPP P P Sbjct: 98 PPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P PP P PPPP PP P P P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP P P PPPP P P Sbjct: 97 PPPPGPPPPGPPPPPGPYYNP 117 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 814 PPPPPPXPXXP-PPPXPPXPPP 876 PP PP P P PP PP PPP Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPP 104 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPX-PPXPPXPXPXXXXXXXPPSPPRP 657 P P P P P P P PP PP P P PP PP P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPP-----PGPPPPPGP 113 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P P PPPP P PP P PP P PP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPP------------PPPGPPPPGPPPP 110 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 48.8 bits (111), Expect = 1e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PP PPP P P P PP PP PP PPPP Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 679 Score = 48.4 bits (110), Expect = 1e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PP PPP P PP APP PP PPPP P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +2 Query: 563 PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P P P PP P P PP PP P P PP PPPP P P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLP--PPPPPPPPVPYPYTPIYP 691 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPPP PPPP PP P PP P PP P P Sbjct: 642 PPPPPP----PPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXP 745 P PP P P P P PPP PP PP P PP PP P P Sbjct: 639 PSYPPPPPPPP-------PPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 41.1 bits (92), Expect = 0.002 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 650 PAXPXPXXXPPXPPPPG---PPXXPPXXPPXXPXPXXXPXP 763 P+ P P PP PPPP P PP PP P P P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 679 Score = 40.7 bits (91), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPP P P PP PP P PP P P P Sbjct: 645 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG G G GGGGG Sbjct: 448 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGGG 496 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 826 PPXPXXPPPPXPPXPP-PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P PPPP PP PP P PP P PP P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPP--PPXXXXXPPXPPRPXPP 961 PP P P PP P P PP PP PP PP P P Sbjct: 643 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GG GG G GGG GA G GG GG GGG Sbjct: 450 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGG 492 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PPPP P PP P P PP P PP PP P Sbjct: 643 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 441 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 491 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P PP P P P P PP P P P PP PP PP P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAP-----PVRPLPPPPPPPPPVPYPYTP 688 Score = 37.5 bits (83), Expect = 0.027 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPP--PPXXXXXPPXPPRPXPP 961 P P P PP P P P P PP P PP P PP Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 679 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXP 615 P PP P P PP P P P P P PP PP P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAP--PVRPLPPPPPPPPPVPYP 685 Score = 37.1 bits (82), Expect = 0.036 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G Sbjct: 441 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG--------G 491 Query: 549 GXGGG 535 G GGG Sbjct: 492 GGGGG 496 Score = 36.3 bits (80), Expect = 0.063 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGG--XXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXX 520 GGG GG G AGG GG G G G G G GG G GGG Sbjct: 441 GGGVGGAGAGAN-AGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGGGANA 499 Query: 519 GGAXXGG 499 GG Sbjct: 500 NSNAFGG 506 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPR----PXXPPXPXP-XPXPPXPPXPXP 615 P P P PPPP+ P PP P P PP PP P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 681 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPP P P P PP PP P P P P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 35.5 bits (78), Expect = 0.11 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G GG GG G GG GG G G GG G G G GGA Sbjct: 442 GGVGGAGAGANAGGFGGGADANSGANGG--GGSAGANAGANGGFGGFGGFG--GGGGGGA 497 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP P P PPP PP P P P P Sbjct: 647 PPPPPPPPQTCCAPVRPPYAPPVRPLP-----PPPPPPPPVPYPYTPIYPNKKTP 696 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG G G G GGGA G G+ G G G GG G G Sbjct: 442 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGG 493 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P PPPP P P PP P P PP P P P Sbjct: 644 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 688 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 7/56 (12%) Frame = -1 Query: 959 AGXGAGGXGXG------GXGXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGGG 813 AG G GG G G G G G G GG GG G GGGGGG Sbjct: 440 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGG 495 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 5/70 (7%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG-----GXXGXGXXXXGXGGAGXGGGXX 529 G G AGGG GG G G G G G G GA G G Sbjct: 427 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 486 Query: 528 PXXGGAXXGG 499 GG GG Sbjct: 487 GGFGGGGGGG 496 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G GG GG G G G G GG G G G Sbjct: 443 GVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGG 494 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPP------RPXXPPXPXPXPXPPXPPXPXP 615 P P P PPP RP P P P PP PP P P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P PP PPPPPP P P P P P Sbjct: 643 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 691 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGG--GGXXGXGGGGGG 813 G G G G G G GG G G GG G GG GGG Sbjct: 441 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGG 492 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXP 609 P PP P PP RP PP P P P P P P Sbjct: 646 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPP-PPPPVPYPYTP 688 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPPPP P P P P Sbjct: 646 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYPNKKTP 696 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P P PPPP P P P Sbjct: 660 PVRPPYAPPV-RPLPPPPPPPPPVPYPYTPIYPNKKTP 696 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 48.8 bits (111), Expect = 1e-05 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PP PPP P P P PP PP PP PPPP Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 819 Score = 48.4 bits (110), Expect = 1e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PP PP PPP P PP APP PP PPPP P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +2 Query: 563 PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P P P PP P P PP PP P P PP PPPP P P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLP--PPPPPPPPVPYPYTPIYP 831 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G G GG Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG----GFGGG 632 Query: 549 GXGG 538 G GG Sbjct: 633 GGGG 636 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPPP PPPP PP P PP P PP P P Sbjct: 782 PPPPPP----PPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXP 745 P PP P P P P PPP PP PP P PP PP P P Sbjct: 779 PSYPPPPPPPP-------PPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 41.1 bits (92), Expect = 0.002 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 650 PAXPXPXXXPPXPPPPG---PPXXPPXXPPXXPXPXXXPXP 763 P+ P P PP PPPP P PP PP P P P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 819 Score = 40.7 bits (91), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPP P P PP PP P PP P P P Sbjct: 785 PPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 826 PPXPXXPPPPXPPXPP-PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P PPPP PP PP P PP P PP P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 39.9 bits (89), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPP--PPXXXXXPPXPPRPXPP 961 PP P P PP P P PP PP PP PP P P Sbjct: 783 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGX---GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG GG G G GGGGG Sbjct: 585 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 PPPP P PP P P PP P PP PP P Sbjct: 783 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG--GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GGG AG G G G GG GG GGG Sbjct: 591 GGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P PP P P P P PP P P P PP PP PP P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAP-----PVRPLPPPPPPPPPVPYPYTP 828 Score = 37.5 bits (83), Expect = 0.027 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPP--PPXXXXXPPXPPRPXPP 961 P P P PP P P P P PP P PP P PP Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 819 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXP 615 P PP P P PP P P P P P PP PP P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAP--PVRPLPPPPPPPPPVPYP 825 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG G GGG GA G GG GG GG Sbjct: 587 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPP-------RPXXPPXPXPXPXPPXPPXPXP 615 P P P PPPP RP P P P PP PP P P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPP P P P PP PP P P P P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G G G GGGA G G+ G G G GG G G G Sbjct: 579 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGG 634 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP P P PPP PP P P P P Sbjct: 787 PPPPPPPPQTCCAPVRPPYAPPVRPLP-----PPPPPPPPVPYPYTPIYPNKKTP 836 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXX 568 G G G G GG G G GG G G G G Sbjct: 564 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 623 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG Sbjct: 624 GGFGGFGGGGGGGANANSNAFGG 646 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P PPPP P P PP P P PP P P P Sbjct: 784 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 828 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---------XGGXGG-GGXXGXGGGGGG 813 AG G GG G G GGG GG GG GG G GGGGGG Sbjct: 577 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G G G GG G G G GGG G G Sbjct: 602 GANGGGGSAGANAGANGGFGGFGGFGGFGGGG-GGGANANSNAFGGYDGFG 651 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P PP PPPPPP P P P P P Sbjct: 783 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 831 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG G GGG GG Sbjct: 594 GGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXP 609 P PP P PP RP PP P P P P P P Sbjct: 786 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPP-PPPPVPYPYTP 828 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 664 GXXGG-GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG GG GG GG G GGG G A G G G G Sbjct: 615 GANGGFGGFGGF--GGFGGGGGGGANANSNAFGGYDGFGFFG 654 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PP PPPPPP P P P P Sbjct: 786 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYPNKKTP 836 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP P P P PPPP P P P Sbjct: 800 PVRPPYAPPV-RPLPPPPPPPPPVPYPYTPIYPNKKTP 836 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 48.8 bits (111), Expect = 1e-05 Identities = 37/112 (33%), Positives = 37/112 (33%), Gaps = 4/112 (3%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXA--GXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 G GRGG G GGGG G G G G GG G Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGGNWQQPQQQQQQHQNQSYEQRDRSDR 395 Query: 783 XXXXGAXGXGXXXGXG--XXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GGG GG G G GG GG Sbjct: 396 NDQQWISGSGRVQGTGWNPQGGRDGG--GRDGGGRDGGGRDGGGRGRGGGGG 445 Score = 39.5 bits (88), Expect = 0.007 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GG GG G GGG G G GGG GG GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGF-----GGGRGGGGGGGGG 370 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G PGGG GG G GGG GG G G G GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G GG G GG GGGG GG G G GGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 37.9 bits (84), Expect = 0.021 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GGG G G GGG GG GG Sbjct: 417 GRDGGGRDGGGRDGGGRDGGGRG-------RGGGGGRGGYRGG 452 Score = 37.1 bits (82), Expect = 0.036 Identities = 32/110 (29%), Positives = 32/110 (29%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXXX 693 GG GG GGGG G GGGGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGGGGGNWQQPQQQQQQHQNQSYEQRDRSDRNDQQWISGSGR 406 Query: 692 XXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGG 543 G GR G G G G G G G G G GG GRGG Sbjct: 407 VQGTGWNPQG--GRDGGG------RDGGGRDGGGRDGGGRGRGGGGGRGG 448 Score = 37.1 bits (82), Expect = 0.036 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGGGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 36.7 bits (81), Expect = 0.048 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G GG GG G GGG GG GGG G GGGGG Sbjct: 336 GGGRGGGGNFRGGRG--------------GGGGGGFGGGRGGGGGGGGG 370 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 622 GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGG GGG G G GG GG GGG G Sbjct: 336 GGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 GG GG GGG GGG G G GGG GG GG Sbjct: 416 GGRDGGGRDGGGRDGGGRDG----GGRGRGGG-GGRGG 448 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGG 843 G G G GG G GGG GG GGGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG G G G GG G GG GG GG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGG 369 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/113 (25%), Positives = 29/113 (25%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXXXX 696 G GG GGGG G GGGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGGNWQQPQQQQQQHQNQSYEQRDR 392 Query: 695 XXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGG 537 G G G G G G GG G GG GRGGGG Sbjct: 393 SDRNDQQWISGSGRVQGTGWNPQGGRDGGGRDG-GGRDGGGRDGGGRGRGGGG 444 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 48.8 bits (111), Expect = 1e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PP P PP P P P PPP PPPP PP PP P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPP--GPPPPPGP 113 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPX--PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P PP PPP P PP PPPPGPP PP P P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPP--PPPGPYYNP 117 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP +P P PA PPPP PP PP P PP Sbjct: 76 PPQWSPGP-PAYPPPPQRPWGPPPPPGPPPP 105 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 647 PPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PPA P P P PPPP P PP PP P P P Sbjct: 83 PPAYPPPPQRPWGPPPP--PGPPPPGPPPPPGPYYNP 117 Score = 38.3 bits (85), Expect = 0.016 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP P P PP P P P PP PP P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPPP P PP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPX-P-XPXPPXPPXP 609 PP P P PPP RP PP P P P PP PP P Sbjct: 76 PPQWSPGPPAYP-PPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = +1 Query: 814 PPPP-----PPXPXXPPPPXPPXPP 873 PPPP PP P PPPP PP PP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP 616 PP PP P PP P P PP P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 817 PPPPPXPXXPPPPX---PPXPPP 876 PPPP P PPPP PP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPPPGPPP 109 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P PP PP P Sbjct: 96 PPPPPGPPPPGPPPPPGP 113 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 PP P P P P P P PP PPPP P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXP 934 PP P PP P P P PPPP P Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P P P P PPP P P P PPPPGP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPP---PGPPPPPGPYYNP 117 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPP PP P PPPP P P Sbjct: 98 PPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P PP P PPPP PP P P P P P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP P P PPPP P P Sbjct: 97 PPPPGPPPPGPPPPPGPYYNP 117 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 814 PPPPPPXPXXP-PPPXPPXPPP 876 PP PP P P PP PP PPP Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPP 104 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPX-PPXPPXPXPXXXXXXXPPSPPRP 657 P P P P P P P PP PP P P PP PP P Sbjct: 70 PRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPP-----PGPPPPPGP 113 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 P P P PPPP P PP P PP P PP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPP------------PPPGPPPPGPPPP 110 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 48.8 bits (111), Expect = 1e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX-PXPXXXPPXPPPPGPPXXPP 718 P P+ P P P P PP P P P P P P P PP PPP PP P Sbjct: 27 PTPSAPAPP---PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Query: 719 XXP 727 P Sbjct: 84 ATP 86 Score = 47.6 bits (108), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPP----PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PPP PP PP P P P P PPPP P PP P P Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP---XXXXXXPPXPPPAXPXPXX 673 P P PPP P PP P P PP P P PP PPP+ P Sbjct: 23 PDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP---- 78 Query: 674 XPPXPPPPG 700 PP P PG Sbjct: 79 PPPDPATPG 87 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 557 PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXX 736 P P P P P P P P PP P P P PPP PP PP P Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPT-PTTTPTPITTPPPPPPSAPPPPDPAT 85 Query: 737 P 739 P Sbjct: 86 P 86 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP---PPPXXXPPXPPPPXXP 665 P P PS PP P PPP P P P P P P P PP PPP P Sbjct: 23 PDNFPTPSAPAPPPKPRP-PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P PP PPP P P P P P PP PP P P P Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXP-XPPAPXPA 960 PP P P P PPPP PP P PP P PP P PA Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPA 84 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSPPR 654 P P P P PPPP P P P P P P P PPS P Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 79 Query: 655 PXXP 666 P P Sbjct: 80 PPDP 83 Score = 39.5 bits (88), Expect = 0.007 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P+ P P P PPPP PP P P P P P Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTP 66 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP----PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P PPP PP PP P PP P P AP P Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 80 Score = 35.9 bits (79), Expect = 0.083 Identities = 44/179 (24%), Positives = 44/179 (24%), Gaps = 28/179 (15%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX---PXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPX- 664 P APP PPP P PP P P P P P P P PP PA P Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGV 88 Query: 665 -----------PXXXPPX---------PPPPG---PPXXPPXXPPXXPXPXXXPXPXAXX 775 PP P PPG PP PP P P Sbjct: 89 WYPLPIYGNAPQFGDPPGSHLLSNSGKPHPPGSQMPPNSGFVLPPAICSPPYGPPNQDGN 148 Query: 776 XXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P PP PPP P PP P Sbjct: 149 PPGSQTPPNSELVPPPAIWNPAYEPPNQIGHPPESQAPTNSGFVPPPAIWNPPYGPPNP 207 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP---XXPPXXPXPXXXPXP 763 P P P PA P PP PPPP PP P P P P P Sbjct: 16 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 72 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPP--XXXPPXPPP 653 P P P P AP P PPP PPPP PP P Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTP 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P PP PPPP P PPPP P P Sbjct: 38 PRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXP-PXPXPPAPXPA 960 P P P P P P PP PPP P P PP P P+ Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPS 76 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 570 PXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P PP P PP PPPP Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPPP 48 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPX--PXPXXXXXXXPPSPPRP 657 PP P P PPPP PP P P P P P PP P P Sbjct: 35 PPKPRPPP---PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPX----PAXPPPPXXXXXPPXPPRPXPP 961 PP P PP P P P PPP PP PP P P Sbjct: 45 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP-PPDPATP 86 Score = 32.3 bits (70), Expect = 1.0 Identities = 37/155 (23%), Positives = 39/155 (25%), Gaps = 14/155 (9%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPX---PXPXPXXXXXXPPXPPPAXPXPXXX--- 676 PP PPP PA P P P P P PP + P Sbjct: 72 PPPPSAPPPPDPATPGVWYPLPIYGNAPQFGDPPGSHLLSNSGKPHPPGSQMPPNSGFVL 131 Query: 677 PPX--PPPPGPPXXP--PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP PP GPP P P P P Sbjct: 132 PPAICSPPYGPPNQDGNPPGSQTPPNSELVPPPAIWNPAYEPPNQIGHPPESQAPTNSGF 191 Query: 845 PPXPX----PXXPPXPAPXPXPAXPPPPXXXXXPP 937 P P P PP P P + PP PP Sbjct: 192 VPPPAIWNPPYGPPNPDGNPPESQTPPNSGFVPPP 226 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P+ P PP PP PP P Sbjct: 20 PYVPDNFPTPSAPAPPPKPRPPPPPPPP 47 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 724 PXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPP 873 P P P PP PPPPPP PPP P P Sbjct: 40 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP---SAPPPPDPATP 86 Score = 29.5 bits (63), Expect = 7.2 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP G PP PP P P P PP P PP Sbjct: 883 PPLRPPNQGGHPPGSQKPPNVGIYPPSTGW--IPPSGPLTQGGHPPG--SQVPSNSVLPP 938 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP P PP P P Sbjct: 939 GSIPPLRPPNQGRHPPGSQVPPNTGLP 965 Score = 29.5 bits (63), Expect = 7.2 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 6/82 (7%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA--PPXPXXXXPXPXXPPX----PXPXPXXXXXXPPXPPPAXP 661 P PP G P P PP P PP P P P Sbjct: 1013 PGSLLPPNTGLPPGSIPPLRPPNQGRHPPGSQVPPNSVLPPGSIPPLGSPIQIGRPVGSQ 1072 Query: 662 XPXXXPPXPPPPGPPXXPPXXP 727 P PPPP P P P Sbjct: 1073 KPASSKIRPPPPSEPQNPDNVP 1094 Score = 29.1 bits (62), Expect = 9.5 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 9/90 (10%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPX---------PPPA 655 P PP PP PP P P P P P PPPA Sbjct: 138 PPYGPPNQDGNPPGSQTPPNSELVPPPAIWNPAYEP-PNQIGHPPESQAPTNSGFVPPPA 196 Query: 656 XPXPXXXPPXPPPPGPPXXPPXXPPXXPXP 745 P PP P P P P P Sbjct: 197 IWNPPYGPPNPDGNPPESQTPPNSGFVPPP 226 Score = 29.1 bits (62), Expect = 9.5 Identities = 22/88 (25%), Positives = 23/88 (26%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P PP G PP + P P PP P PP P P Sbjct: 982 PGSQKPPNSGIYPPSTGSIP-PSGPLTQGGHPPGSLLPPNTGLPPGSIPPLRPPNQGRHP 1040 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP P P P Sbjct: 1041 PGSQVPPNSVLPPGSIPPLGSPIQIGRP 1068 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 48.4 bits (110), Expect = 1e-05 Identities = 33/109 (30%), Positives = 34/109 (31%), Gaps = 1/109 (0%) Frame = +2 Query: 635 PPXPPPAXPXPXXXP-PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXX 811 PP PP P P P P PP P P PP PP P P + Sbjct: 107 PPKYPPYPPYPHYSPYPAPPYPYPGYYPP-PPPPYPYPYPGHGGHSGSGGHDSGHGGHHH 165 Query: 812 XXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P PP P PP PP P P Sbjct: 166 HTTTTTTTTTTTKKPNHGQYP-PPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 44.0 bits (99), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXP 615 P P PPPP P PP P P PP PP P P Sbjct: 180 PNHGQYPPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 41.1 bits (92), Expect = 0.002 Identities = 32/112 (28%), Positives = 32/112 (28%) Frame = +1 Query: 541 PPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXXX 720 PP P PP P P P PP P P PP PP P Sbjct: 107 PPKYPPYPPYPHYSPYPA-PPYPYPGYY----PPPPPPYPYPYPGHGGHSGSGGHDSGH- 160 Query: 721 XPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 G PPPPPP P PP P P PPP Sbjct: 161 ------GGHHHHTTTTTTTTTTTKKPNHGQYPPPPPPPPYYPPYPYYPPPPP 206 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPP 623 P+ PPP PP PP P P P PPP PPP Sbjct: 180 PNHGQYPPPPPP-PPYYPPYPYYPPPPPPPPLPPP 213 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP PP P P P P P P P PP PPP P Sbjct: 105 PYPPKYPPYP--PYPHYSPYPAPPYPYPGYYPPPPPPYPYP 143 Score = 37.5 bits (83), Expect = 0.027 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPP 626 PP PPP P P P PPP PP P Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLP 211 Score = 37.1 bits (82), Expect = 0.036 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 558 PPPXPXAPXXXXXPXPPPAPPPPXXXPP 641 PPP P P P PP PPPP PP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P PP PPP P P PPPP PP PP Sbjct: 180 PNHGQYPPPPPPPPYYPPYPYYPPPPPP-PPLPPP 213 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 597 PXPPPAPPPPXXXPPXPPPPXXP 665 P PPP PP PP PPPP P Sbjct: 189 PPPPPYYPPYPYYPPPPPPPPLP 211 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 597 PXPPPAPPPPXXXPPXPPPPXXP 665 P PP PP P PP PPPP P Sbjct: 190 PPPPYYPPYPYYPPPPPPPPLPP 212 Score = 34.3 bits (75), Expect = 0.25 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 20/106 (18%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXP------------------XXX 625 PP P P PAPP P P PP P P P Sbjct: 107 PPKYPPYPPYPHYSPYPAPPYPYPGYYPPPPPPYPYPYPGHGGHSGSGGHDSGHGGHHHH 166 Query: 626 XXXPPXPPPAXPXPXXXPPXPPPPGPPXXP--PXXPPXXPXPXXXP 757 P PPPP PP P P PP P P P Sbjct: 167 TTTTTTTTTTTKKPNHGQYPPPPPPPPYYPPYPYYPPPPPPPPLPP 212 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P P PP P P P P P P P PPP P P Sbjct: 102 PYYPYPPKYPPYPPYPHYSPYPAP-PYPYPGYYPPPPPPYPYP 143 Score = 30.7 bits (66), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P PP P P PP PPP P P Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPP 567 PP P P PPPP P PP Sbjct: 191 PPPYYPPYPYYPPPPPPPPLPPP 213 Score = 29.5 bits (63), Expect = 7.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPP-PXPXAPXXXXXPXPPPAPPPP 626 P P PP P P P P P P PPP P P Sbjct: 105 PYPPKYPPYPPYPHYSPYPAPPYPYPGYYPPPPPPYPYP 143 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 596 PXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 P P P P P PPP P PP PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPP-----PPLPPP 213 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXP 942 PP PP P P P PP P P P PP P P Sbjct: 111 PPYPPYPHYSPYPAPPYPYPGYYPP---------PPPPYPYP 143 Score = 28.3 bits (60), Expect(2) = 0.047 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 571 PXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P PP PP P PP PP P P Sbjct: 180 PNHGQYPPPPPPPPYYPPYPYYPPPPPPPPLP 211 Score = 27.5 bits (58), Expect(2) = 0.047 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRP-XXPPXPXPXPXP 591 P P P P PP P P PP P P P P Sbjct: 105 PYPPKYPPYPPYPHYSPYPAPPYPYPGYYPPPPPPYPYP 143 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 47.2 bits (107), Expect = 3e-05 Identities = 29/89 (32%), Positives = 29/89 (32%), Gaps = 3/89 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP AP PPP AP P P P P PP P P P Sbjct: 146 PPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYL-PPAPVARYLPPKVAP 204 Query: 680 PXPPPPGPPXXPP---XXPPXXPXPXXXP 757 PPPP PP P PP P P Sbjct: 205 SLPPPPPPPPVAPKKLYLPPAEPETKYLP 233 Score = 45.6 bits (103), Expect = 1e-04 Identities = 38/147 (25%), Positives = 38/147 (25%), Gaps = 3/147 (2%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXX---PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX 685 PP PPP P P P PP P P PPP P P Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPT 167 Query: 686 PPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 PP PP PP P P A P P P Sbjct: 168 YLPPSPPESKYLPPPTPEVKYLPPAPVA-----------------RYLPPKVAPSLPPPP 210 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP AP P P PP P Sbjct: 211 PPPPVAPKKLYLPPAEPETKYLPPSEP 237 Score = 44.8 bits (101), Expect = 2e-04 Identities = 37/135 (27%), Positives = 38/135 (28%), Gaps = 2/135 (1%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPG-PPXXPPXX 724 P P P PP P P P PP+ P PP P PP P Sbjct: 99 PEKPRQKYLPPKVSLPPPPPPPPKATYL-----PPSKPEVKYLPPEPVAKYLPPKVAPSL 153 Query: 725 PPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP-XXPPXPAPXPXPA 901 PP P P P P PP P PP AP P Sbjct: 154 PPPPPPPVVAPKP----TYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPP 209 Query: 902 XPPPPXXXXXPPXPP 946 PPPP PP Sbjct: 210 PPPPPVAPKKLYLPP 224 Score = 43.6 bits (98), Expect = 4e-04 Identities = 32/103 (31%), Positives = 33/103 (32%), Gaps = 17/103 (16%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPX--PXPXPXXXXXXPPXPPPAXP 661 PP PP PP P PP P P P P P P P PP+ P Sbjct: 115 PPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPP 174 Query: 662 XPXXXPPXPP-----PPGP------PXXPPXXPPXXPXPXXXP 757 PP P PP P P P PP P P P Sbjct: 175 ESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 35.9 bits (79), Expect = 0.083 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXX-----PPXPXPXPXXXXXXPPXPPPAXPX 664 PP PP P P P P P PP P P PPP P Sbjct: 154 PPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P PP P PP P P Sbjct: 214 PVAPKKLYLPPAEP-ETKYLPPSEPVEKYLP 243 Score = 35.5 bits (78), Expect = 0.11 Identities = 29/111 (26%), Positives = 29/111 (26%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXX 793 P PP P P PPPP PP P P P A Sbjct: 91 PSGYSYGPPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVA-------- 142 Query: 794 XXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P P PP AP P P PP PP P Sbjct: 143 ---------KYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 34.7 bits (76), Expect = 0.19 Identities = 29/114 (25%), Positives = 29/114 (25%), Gaps = 4/114 (3%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPX---PXAPXXXXXPXPPPAPPPPXXXPP-XPPPPXXPXXXXXXX 686 P PPP PP P P P P P A P P PPPP P Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPT 167 Query: 687 XXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXPP 848 P PP P PPP PP P Sbjct: 168 YLPPSPPESKYLPPPTPEVKYLPPAP----VARYLPPKVAPSLPPPPPPPPVAP 217 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXP-XPPPAPPPPXXXPPXPP 650 P P PP P PP P P P PP+PP PP P Sbjct: 138 PEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 5/120 (4%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPP----XPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXX 699 P P + PP P PP PP P PP P P Sbjct: 98 PPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPP 157 Query: 700 XXXXXXXXP-XPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP PP P PPPP PP P Sbjct: 158 PPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 39/173 (22%), Positives = 39/173 (22%), Gaps = 13/173 (7%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXP--------XPXPPXPPXPXPXXXXXX 633 P PP P P P PP P PP PP P Sbjct: 109 PKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTY 168 Query: 634 XPPSPPR-----PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXX 798 PPSPP P P P P PP Sbjct: 169 LPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAP-SLPPPPPPPPVAPKKLYLPPAEP 227 Query: 799 XXXXXPPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP P PP P PP P P PAP P Sbjct: 228 ETKYLPPSEPVEKYLPPKPEQKYLPP----QPEVDFHIPIPSYALPLGPAPSP 276 Score = 32.3 bits (70), Expect = 1.0 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 8/96 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 PP +PP PPP P PP P P P P P PP PPP P Sbjct: 170 PP--SPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPS-LPPP------PP-PPPVAPKK 219 Query: 668 XXXPPXPPPPG--PPXXP--PXXPPXXPXPXXXPXP 763 PP P PP P PP P P Sbjct: 220 LYLPPAEPETKYLPPSEPVEKYLPPKPEQKYLPPQP 255 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 PP P P P PPP PP PP P Sbjct: 98 PPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKP 131 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PS PPP P P P PP+ P PP P P Sbjct: 204 PSLPPPPPPPPVAPKKLYLPPAEPETKYLPPSEPVEKYLPPKPEQKYLP 252 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 47.2 bits (107), Expect = 3e-05 Identities = 29/89 (32%), Positives = 29/89 (32%), Gaps = 3/89 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP AP PPP AP P P P P PP P P P Sbjct: 146 PPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYL-PPAPVARYLPPKVAP 204 Query: 680 PXPPPPGPPXXPP---XXPPXXPXPXXXP 757 PPPP PP P PP P P Sbjct: 205 SLPPPPPPPPVAPKKLYLPPAEPETKYLP 233 Score = 45.6 bits (103), Expect = 1e-04 Identities = 38/147 (25%), Positives = 38/147 (25%), Gaps = 3/147 (2%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXX---PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX 685 PP PPP P P P PP P P PPP P P Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPT 167 Query: 686 PPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 PP PP PP P P A P P P Sbjct: 168 YLPPSPPESKYLPPPTPEVKYLPPAPVA-----------------RYLPPKVAPSLPPPP 210 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP AP P P PP P Sbjct: 211 PPPPVAPKKLYLPPAEPETKYLPPSEP 237 Score = 44.8 bits (101), Expect = 2e-04 Identities = 37/135 (27%), Positives = 38/135 (28%), Gaps = 2/135 (1%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPG-PPXXPPXX 724 P P P PP P P P PP+ P PP P PP P Sbjct: 99 PEKPRQKYLPPKVSLPPPPPPPPKATYL-----PPSKPEVKYLPPEPVAKYLPPKVAPSL 153 Query: 725 PPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP-XXPPXPAPXPXPA 901 PP P P P P PP P PP AP P Sbjct: 154 PPPPPPPVVAPKP----TYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPP 209 Query: 902 XPPPPXXXXXPPXPP 946 PPPP PP Sbjct: 210 PPPPPVAPKKLYLPP 224 Score = 43.6 bits (98), Expect = 4e-04 Identities = 32/103 (31%), Positives = 33/103 (32%), Gaps = 17/103 (16%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPX--PXPXPXXXXXXPPXPPPAXP 661 PP PP PP P PP P P P P P P P PP+ P Sbjct: 115 PPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPP 174 Query: 662 XPXXXPPXPP-----PPGP------PXXPPXXPPXXPXPXXXP 757 PP P PP P P P PP P P P Sbjct: 175 ESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 35.9 bits (79), Expect = 0.083 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXX-----PPXPXPXPXXXXXXPPXPPPAXPX 664 PP PP P P P P P PP P P PPP P Sbjct: 154 PPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 Query: 665 PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P PP P PP P P Sbjct: 214 PVAPKKLYLPPAEP-ETKYLPPSEPVEKYLP 243 Score = 35.5 bits (78), Expect = 0.11 Identities = 29/111 (26%), Positives = 29/111 (26%) Frame = +2 Query: 614 PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXX 793 P PP P P PPPP PP P P P A Sbjct: 91 PSGYSYGPPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVA-------- 142 Query: 794 XXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P P PP AP P P PP PP P Sbjct: 143 ---------KYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 34.7 bits (76), Expect = 0.19 Identities = 29/114 (25%), Positives = 29/114 (25%), Gaps = 4/114 (3%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPX---PXAPXXXXXPXPPPAPPPPXXXPP-XPPPPXXPXXXXXXX 686 P PPP PP P P P P P A P P PPPP P Sbjct: 108 PPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPT 167 Query: 687 XXXXXXXXXXXXXXPXXRXPXXPPXPXXXXXXXXXXXXXXXXXXXPPPXPPXPP 848 P PP P PPP PP P Sbjct: 168 YLPPSPPESKYLPPPTPEVKYLPPAP----VARYLPPKVAPSLPPPPPPPPVAP 217 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXP-XPPPAPPPPXXXPPXPP 650 P P PP P PP P P P PP+PP PP P Sbjct: 138 PEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 33.1 bits (72), Expect = 0.59 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 5/120 (4%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPP----XPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXX 699 P P + PP P PP PP P PP P P Sbjct: 98 PPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPP 157 Query: 700 XXXXXXXXP-XPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P PP PP P PPPP PP P Sbjct: 158 PPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 39/173 (22%), Positives = 39/173 (22%), Gaps = 13/173 (7%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXP--------XPXPPXPPXPXPXXXXXX 633 P PP P P P PP P PP PP P Sbjct: 109 PKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTY 168 Query: 634 XPPSPPR-----PXXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXX 798 PPSPP P P P P PP Sbjct: 169 LPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAP-SLPPPPPPPPVAPKKLYLPPAEP 227 Query: 799 XXXXXPPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP P PP P PP P P PAP P Sbjct: 228 ETKYLPPSEPVEKYLPPKPEQKYLPP----QPEVDFHIPIPSYALPLGPAPSP 276 Score = 32.3 bits (70), Expect = 1.0 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 8/96 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 PP +PP PPP P PP P P P P P PP PPP P Sbjct: 170 PP--SPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPS-LPPP------PP-PPPVAPKK 219 Query: 668 XXXPPXPPPPG--PPXXP--PXXPPXXPXPXXXPXP 763 PP P PP P PP P P Sbjct: 220 LYLPPAEPETKYLPPSEPVEKYLPPKPEQKYLPPQP 255 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 PP P P P PPP PP PP P Sbjct: 98 PPEKPRQKYLPPKVSLPPPPPPPPKATYLPPSKP 131 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PS PPP P P P PP+ P PP P P Sbjct: 204 PSLPPPPPPPPVAPKKLYLPPAEPETKYLPPSEPVEKYLPPKPEQKYLP 252 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 46.8 bits (106), Expect = 4e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 PPP PP PPP P P P PPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +3 Query: 552 PXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PPP P P PPP PPPP PP PPPP P Sbjct: 463 PPPPPPP--------PPPPPPPPPPTEPPPPPPPPPEP 492 Score = 44.0 bits (99), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXP 615 P PPPP P PP P P PP PP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP PP PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPP 483 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPTEPPP 484 Score = 44.0 bits (99), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXP 615 P PPPP P PP P P PP PP P P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP P PPP Sbjct: 466 PPPPPPPPPPPPPPTEPPPPP 486 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPP PP PPP Sbjct: 467 PPPPPPPPPPPPPTEPPPPPP 487 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP PP P P Sbjct: 472 PPPPPPPPTEPPPPPPPPPEP 492 Score = 43.6 bits (98), Expect = 4e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXPXP 745 P P PP PPPP PP PP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 43.2 bits (97), Expect = 5e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PP P P P P PPPP PP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPP-----PPPPPEP 492 Score = 43.2 bits (97), Expect = 5e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PPPP PP PP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 41.9 bits (94), Expect = 0.001 Identities = 16/23 (69%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +1 Query: 814 PPPPPPXPXXPP--PPXPPXPPP 876 PPPPPP P PP PP PP PPP Sbjct: 468 PPPPPPPPPPPPTEPPPPPPPPP 490 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P PP PPP P P P PPPP PP P Sbjct: 438 PSYPDDSYPDVIYDDHPHHHHHVHHPPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 PP PPP P P PP PPP PP PP PP P Sbjct: 463 PPPPPPPPPPP---PPPPPPTEPP--PPPPPPPEP 492 Score = 41.1 bits (92), Expect = 0.002 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPPP PP PP PP P P P Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 40.7 bits (91), Expect = 0.003 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPPP PP PP PP P P P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P P PPPP PP PP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXP 609 P P PPPP P PP P P PP PP P Sbjct: 463 PPPPPPPPPPPPPP--PPPTEPPPPPPPPPEP 492 Score = 35.9 bits (79), Expect = 0.083 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 562 PPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 PP P P P PP PP P PP PR Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 493 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXP 585 PP P P PPP P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 502 PXXXPXXXXXPXPPPPRPXXPPXPXPXPXP 591 P P P PPPP PP P P P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p protein. Length = 285 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 35 APGSGSIGGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 84 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 85 IGGGSIDSGLGGLGGLGG 102 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 64 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGX-GGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G GGG GG GG G G G Sbjct: 44 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G GG GG G GGG GG G G GGG G G GG G Sbjct: 42 GGGSIGGGSIGGGSIGG--GSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Query: 582 XGXXXXG 562 G G Sbjct: 100 LGGLGGG 106 Score = 39.5 bits (88), Expect = 0.007 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G GG G G GGG G G G GG G G G G Sbjct: 26 GHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 83 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 84 SIGGGSIDSGLGGLGG 99 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG GG GGG GGG G GGG G GG G G Sbjct: 39 GSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 88 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 53 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 >BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p protein. Length = 279 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 29 APGSGSIGGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 78 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 79 IGGGSIDSGLGGLGGLGG 96 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 58 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 100 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGX-GGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G GGG GG GG G G G Sbjct: 38 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G GG GG G GGG GG G G GGG G G GG G Sbjct: 36 GGGSIGGGSIGGGSIGG--GSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 Query: 582 XGXXXXG 562 G G Sbjct: 94 LGGLGGG 100 Score = 39.5 bits (88), Expect = 0.007 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G GG G G GGG G G G GG G G G G Sbjct: 20 GHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 77 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 78 SIGGGSIDSGLGGLGG 93 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG GG GGG GGG G GGG G GG G G Sbjct: 33 GSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 82 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 47 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 100 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GGGG+GGG G GA GGG G GGG Sbjct: 89 GRGGGGGGGG---GGGGSGGG-GRGGGSGARAGGGGRAGDGGG 127 Score = 37.5 bits (83), Expect = 0.027 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GG GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGG 111 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 GG GGGG GG G G GGG G G G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 36.3 bits (80), Expect = 0.063 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 640 GGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG-XGGGXXXXXGXG 512 G G GG GGG G G G GGG G GGG G G Sbjct: 84 GRSREGRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 36.3 bits (80), Expect = 0.063 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXG----AGXGGXXGXGXG 847 GRGG GG GG G G G G AG GG G G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 608 GXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GG GG G G G G GRGGG G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G GG GG GG GGG G G GGG G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAG 123 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GG GG GGG G G G AG G G Sbjct: 89 GRGGGGGGGGGG---GGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 G G GG GGGG G GGGG G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRG 109 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 GGG GG G G GGG GG G G G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGG 816 GGG GG GG G G GGG G Sbjct: 94 GGGGGGGGGSGGGGRGGGSG 113 Score = 32.7 bits (71), Expect = 0.77 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGG G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSG 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGG-XGGGGXXGXGGG 822 G G GG G GG G GGG G GGGG G GGG Sbjct: 89 GRGGGGGGGGGGGGSGGGGR-------GGGSGARAGGGGRAGDGGG 127 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GGG GG G GG G GGGG Sbjct: 89 GRGGGGGGGGG--------------GGGSGGGGRGGGSGARAGGGG 120 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG 846 G G G GG G GG GGG G GGG Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 G G GGGG G GGGG G Sbjct: 84 GRSREGRGGGGGGGGGGGGSG 104 >AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p protein. Length = 286 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 35 APGSGSISGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 84 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 85 IGGGSIDSGLGGLGGLGG 102 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 64 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGG-XGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G G GG GG GG G G G Sbjct: 44 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Score = 37.1 bits (82), Expect = 0.036 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G G G G GGG G G G GG G G G G Sbjct: 26 GHSSSGLSFAPGSGSISGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 83 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 84 SIGGGSIDSGLGGLGG 99 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GG GGG GGG G GGG G GG G G Sbjct: 39 GSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGG--XGXXXXXGAXGXGG-GXGGXGGG 536 G G G GGG GGG G G G G G G GGG Sbjct: 37 GSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGG 79 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 53 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GG GGGG+GGG G GA GGG G GGG Sbjct: 89 GRGGGGGGGG---GGGGSGGG-GRGGGSGARAGGGGRAGDGGG 127 Score = 37.5 bits (83), Expect = 0.027 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GG GGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGG 111 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 GG GGGG GG G G GGG G G G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 36.3 bits (80), Expect = 0.063 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 640 GGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG-XGGGXXXXXGXG 512 G G GG GGG G G G GGG G GGG G G Sbjct: 84 GRSREGRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 36.3 bits (80), Expect = 0.063 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXG----AGXGGXXGXGXG 847 GRGG GG GG G G G G AG GG G G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 608 GXGGXGGXGXGXGXGGXXGRGGGGXGXXXXXGXXXGG 498 G GG GG G G G G GRGGG G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G GG GG GG GGG G G GGG G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAG 123 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GG GG GGG G G G AG G G Sbjct: 89 GRGGGGGGGGGG---GGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 G G GG GGGG G GGGG G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRG 109 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 GGG GG G G GGG GG G G G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGG 816 GGG GG GG G G GGG G Sbjct: 94 GGGGGGGGGSGGGGRGGGSG 113 Score = 32.7 bits (71), Expect = 0.77 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGG G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSG 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 956 GXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGG-XGGGGXXGXGGG 822 G G GG G GG G GGG G GGGG G GGG Sbjct: 89 GRGGGGGGGGGGGGSGGGGR-------GGGSGARAGGGGRAGDGGG 127 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GGG GG G GG G GGGG Sbjct: 89 GRGGGGGGGGG--------------GGGSGGGGRGGGSGARAGGGG 120 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG 846 G G G GG G GG GGG G GGG Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 G G GGGG G GGGG G Sbjct: 84 GRSREGRGGGGGGGGGGGGSG 104 >AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB, isoform B protein. Length = 279 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 29 APGSGSIGGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 78 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 79 IGGGSIDSGLGGLGGLGG 96 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 58 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 100 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGX-GGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G GGG GG GG G G G Sbjct: 38 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G GG GG G GGG GG G G GGG G G GG G Sbjct: 36 GGGSIGGGSIGGGSIGG--GSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 93 Query: 582 XGXXXXG 562 G G Sbjct: 94 LGGLGGG 100 Score = 39.5 bits (88), Expect = 0.007 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G GG G G GGG G G G GG G G G G Sbjct: 20 GHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 77 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 78 SIGGGSIDSGLGGLGG 93 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG GG GGG GGG G GGG G GG G G Sbjct: 33 GSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 82 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 47 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 100 >AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA, isoform A protein. Length = 285 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 35 APGSGSIGGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 84 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 85 IGGGSIDSGLGGLGGLGG 102 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 64 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGX-GGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G GGG GG GG G G G Sbjct: 44 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G G GG GG G GGG GG G G GGG G G GG G Sbjct: 42 GGGSIGGGSIGGGSIGG--GSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Query: 582 XGXXXXG 562 G G Sbjct: 100 LGGLGGG 106 Score = 39.5 bits (88), Expect = 0.007 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G GG G G GGG G G G GG G G G G Sbjct: 26 GHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 83 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 84 SIGGGSIDSGLGGLGG 99 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG GG GGG GGG G GGG G GG G G Sbjct: 39 GSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 88 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 53 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 >AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA protein. Length = 286 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G GG GG G GGG GG G G GGG G G GG Sbjct: 35 APGSGSISGGSIGGGSIGG--GSIGGGSIGGGLIGGGSIGGGSIG--------GGSLGGS 84 Query: 588 XGXGXXXXGXGGAGXGGG 535 G G G GG G GG Sbjct: 85 IGGGSIDSGLGGLGGLGG 102 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG GG GGG GG G G GG GG GGG Sbjct: 64 GLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGG-XGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GGG G G GG GG GG G G G Sbjct: 44 GSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGG 99 Score = 37.1 bits (82), Expect = 0.036 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G PG G G G G GGG G G G GG G G G G Sbjct: 26 GHSSSGLSFAPGSGSISGGSIGGGSIGGGSIG--GGSIGGGLIGGGSIGGGSIGGGSLGG 83 Query: 549 GXGGGXXPXXGGAXXG 502 GGG G G Sbjct: 84 SIGGGSIDSGLGGLGG 99 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GG GG GGG GGG G GGG G GG G G Sbjct: 39 GSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG-GGSLGGSIGGG 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGG--XGXXXXXGAXGXGG-GXGGXGGG 536 G G G GGG GGG G G G G G G GGG Sbjct: 37 GSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGG 79 Score = 29.1 bits (62), Expect = 9.5 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGX----GGGGXXGXGGGGGG 813 G G G G G G GG GG G GG G GG GGG Sbjct: 53 GGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGG 106 >X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. Length = 345 Score = 46.0 bits (104), Expect = 8e-05 Identities = 33/93 (35%), Positives = 33/93 (35%), Gaps = 7/93 (7%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-------XAGGGXGGXXXXXXGXGXGX 598 G G G GG G GG GG G G AGG G G G G Sbjct: 233 GGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYG- 291 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 GG G G G GG GG P GG GG Sbjct: 292 GGFEGNGYGGGGGGGNMGGGRGGPRGGGGPKGG 324 Score = 43.6 bits (98), Expect = 4e-04 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 6/88 (6%) Frame = -3 Query: 744 GXGXXGGXXGGXXG-GPGGGGX---GGXXXGX--GXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG GG G G GG G GG G G G G GG G G GG G Sbjct: 250 GQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGGNMG 309 Query: 582 XGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G GG GGG GG GG Sbjct: 310 GGRGGPRGGGGPKGGGG--FNGGKQRGG 335 Score = 43.2 bits (97), Expect = 5e-04 Identities = 35/119 (29%), Positives = 35/119 (29%) Frame = -3 Query: 909 GGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXGAXGXGXXXGXGXX 730 GG G G GG G G G GA G G G Sbjct: 221 GGMRGGPRGGMRGGRGGYG--GRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYY 278 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGG 553 G G G GGG G G G GG GG G G GG G G GG Sbjct: 279 NGYDYGYDGYGYGGGFEGNGYGGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 337 Score = 42.3 bits (95), Expect = 0.001 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGG-GGXGGXXX------GXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G GG GG GG GG GG GG G GGG GG G G G Sbjct: 222 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 281 Query: 579 --GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 282 DYGYDGYGYGGGFEGNGYGGGGGGGNMGG 310 Score = 42.3 bits (95), Expect = 0.001 Identities = 28/72 (38%), Positives = 28/72 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G G G GG G G GGG GG G G GG G G GG Sbjct: 275 GGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGG------NMGGGRGGPRGGGGPK---GGG 325 Query: 549 GXGGGXXPXXGG 514 G GG GG Sbjct: 326 GFNGGKQRGGGG 337 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGG G GGGG GG G G G GG GG G G G Sbjct: 287 GYGYGGGFEGNGYGGGGGGGNMG-GGRGGPRGGGGPKGGGGFNGGKQRGGG 336 Score = 36.7 bits (81), Expect = 0.048 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGG GG G G G GG GGG Sbjct: 300 GGGGGGGNM--GGGRGGPRGGGGPKGGGGFNGGKQRGGGG 337 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGG 536 G GG GG G G GG GG G+ G GGG GG G G Sbjct: 222 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAG 267 Score = 33.1 bits (72), Expect = 0.59 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G G G GG G R GGG G GGG G GGGG Sbjct: 289 GYGGGFEGNGYGGGGGGGNMGGGRGGPRGGGGPKG-GGGFNGGKQRGGGG 337 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXG 853 G G G GG GGG G G G GG G G Sbjct: 284 GYDGYGYGGGFEGNGYGGGGGGGNMGGGRGGPRGGG 319 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXG-XGAGXGGXXGXGXGG 844 GG G G GGG G G G G GG G G GG Sbjct: 275 GGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGGNMGGGRGG 314 >AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p protein. Length = 773 Score = 46.0 bits (104), Expect = 8e-05 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GGPGG G GG G G G G GG G G G Sbjct: 445 GGGPGGAGPSGGGPGGAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGG 504 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 GG G GG GG Sbjct: 505 GGGGGPGGRGRWSDDEDEGG 524 Score = 40.7 bits (91), Expect = 0.003 Identities = 30/106 (28%), Positives = 30/106 (28%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 GAG G GG G G G GG GGG G GGGGGG Sbjct: 460 GAGTGGGGPGGRQQGPGFFNPRNPFNDNQRG-RGGQSGGGVRGVGGGGGGGPGGRGRWSD 518 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGG 645 GGPG G GRGG Sbjct: 519 DEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNNSRGGRGG 564 Score = 39.9 bits (89), Expect = 0.005 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 8/95 (8%) Frame = +2 Query: 503 PXXAPPXXGXXPP--------PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX 658 P PP G PP P P P P P P PPP Sbjct: 133 PVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPMM 192 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P G P P PP P P P Sbjct: 193 MPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVP 227 Score = 37.5 bits (83), Expect = 0.027 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P PPP P P P P P PP P P P Sbjct: 125 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPT 184 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 PP P PP P P P A Sbjct: 185 TNMPPPMMMPPTMMPPGFPGIGGPPHPMA 213 Score = 34.3 bits (75), Expect = 0.25 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 5/113 (4%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G G GGG G G G G GG G G GG Sbjct: 430 GNGGNGVGPMFMRNQGGGPGGAGPSGGGPGG-AGTGGGG-----PGGRQQGPGFFNPRNP 483 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAG----GGXGG 634 G G G G G GG GGPGG G G GG GG Sbjct: 484 FNDNQRGRGGQSGGGVR-GVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGG 535 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 G G G G G G G G G G G GG G GG Sbjct: 430 GNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGG 470 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 705 GGPGG-GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GGP G GG G GGG GG G G G G G G G Sbjct: 426 GGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGGRQQGPG 476 Score = 31.5 bits (68), Expect = 1.8 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXPX 670 PP PP PPP P P PP P PP P PP P P Sbjct: 167 PPIMMPPT--NMPPPMMMP--TTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFP- 221 Query: 671 XXPPXPPPPGP 703 P PPP P Sbjct: 222 -PPGAVPPPIP 231 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P+ PP P P P P P PP PP PP P Sbjct: 177 PPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 231 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G G G G G GG GGG GG Sbjct: 427 GPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGG 470 Score = 29.9 bits (64), Expect = 5.5 Identities = 28/108 (25%), Positives = 28/108 (25%), Gaps = 3/108 (2%) Frame = +2 Query: 644 PPPAXPX-PXXXPPXP--PPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PPP P P PP P PPPG P P P P Sbjct: 125 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAP-PMGINMPPPIMMPPTNMPPPMMMP 183 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PP P P P P Sbjct: 184 TTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 231 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GG G GGG G G G G GG G G Sbjct: 427 GPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPG 469 Score = 29.5 bits (63), Expect = 7.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +1 Query: 820 PPPPXPXXP--PPPXPPXPPPXXXXXXXXXXXXXXP-----XPPXPXPPAPXP 957 PPP P P PPP P PPP P PP PP P Sbjct: 125 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMP 177 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 46.0 bits (104), Expect = 8e-05 Identities = 41/156 (26%), Positives = 41/156 (26%), Gaps = 12/156 (7%) Frame = +2 Query: 515 PPXXGXXPPPXP----APPXPXXXXPXPXX--PPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 PP PPP APP P P P P PP PPP Sbjct: 134 PPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTP 193 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PP PP PP P P PP P Sbjct: 194 PPPPPTKKVVYTPPPPPPPPKKVVYTPPPTG-----ILKDDGYHYGQPSVKFEVSAPPAP 248 Query: 857 XPXXPPXP------APXPXPAXPPPPXXXXXPPXPP 946 P P AP P PP PP PP Sbjct: 249 KVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPP 284 Score = 43.6 bits (98), Expect = 4e-04 Identities = 34/127 (26%), Positives = 34/127 (26%), Gaps = 4/127 (3%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAX 772 PP P P P PPP PP PPP P PP P P Sbjct: 265 PPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPT- 323 Query: 773 XXXXXXXXXXXXXXXXXXXXXXXXPPXP-XPXXPPXPAPXPXPAXP---PPPXXXXXPPX 940 PP P PP P A P PPP Sbjct: 324 ---GILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYT 380 Query: 941 PPRPXPP 961 PP P PP Sbjct: 381 PPPPPPP 387 Score = 42.7 bits (96), Expect = 7e-04 Identities = 36/152 (23%), Positives = 37/152 (24%), Gaps = 5/152 (3%) Frame = +2 Query: 512 APPXXGXXPPPX-----PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 APP PP P PP P P P P PP PPP Sbjct: 150 APPPVYVPPPTKKVVYTPPPPPPTKKV---VYTPPPPPPTKKVVYTPPPPPPTKKVVYTP 206 Query: 677 PPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 PP PPPP P + P P Sbjct: 207 PPPPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPTKKVVIAPPP 266 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P PPP P PP P Sbjct: 267 VYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPP 298 Score = 38.7 bits (86), Expect = 0.012 Identities = 38/153 (24%), Positives = 38/153 (24%), Gaps = 3/153 (1%) Frame = +2 Query: 512 APPXXGXXPPPXP---APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 APP PP PP P PP P P PP PPP P Sbjct: 263 APPPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPP----PKKVVY 318 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP 862 PPP G P A PP Sbjct: 319 TPPPTGILKDDGYHYGQPSVKFEVSAPPA---PKVEYLPPPPTKKVYVAPPVYVPPPTKK 375 Query: 863 XXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P PPP PP P PP Sbjct: 376 VVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 513 PXPSXXXXPPPXPPX------PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P PPP PP PPP P P PPP PPPP PPP Sbjct: 272 PTKKVIYTPPPPPPTKKVVYTPPPPP--PTKKVVYTPPPPPPPPKKVVYTPPP 322 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 519 PSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PPP PPP P P PPP PP PPPP Sbjct: 264 PPPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPP 312 Score = 36.7 bits (81), Expect = 0.048 Identities = 34/138 (24%), Positives = 36/138 (26%), Gaps = 12/138 (8%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXX--PPXPXPXPX---PPXPPXPXPXXXXXXXPPSPPRPXX 663 PP P PPP + PP P P P PP P P PP+ Sbjct: 270 PPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDD 329 Query: 664 PXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXX-PPPPPPXPX 840 P PP PPPPPP Sbjct: 330 GYHYGQPSVKFEVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVY 389 Query: 841 XPPPP------XPPXPPP 876 PPP PP PPP Sbjct: 390 IPPPTKKVVVYTPPPPPP 407 Score = 35.9 bits (79), Expect = 0.083 Identities = 33/156 (21%), Positives = 34/156 (21%), Gaps = 7/156 (4%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPP---XPPXPXPXXXXXXXPPSPPRP---- 657 PP P PPP + P P P PP P P PP PP P Sbjct: 157 PPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKV 216 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXP 837 PP PPP Sbjct: 217 VYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKV 276 Query: 838 XXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PPP PP PP P PP Sbjct: 277 IYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPP 312 Score = 33.9 bits (74), Expect = 0.34 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 519 PSXXXXPPPXPPX---PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PPP PPP P P PPP P P PPPP Sbjct: 151 PPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPP-PTKKVVYTPPPPPP 198 Score = 33.9 bits (74), Expect = 0.34 Identities = 36/156 (23%), Positives = 36/156 (23%), Gaps = 3/156 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P PP P P P P P P P PPP P P Sbjct: 167 PPPPPPTKKVVYTPPPPPPTKKVVYTP-------PPPPPTKKVVYTPPPPP--PPPKKVV 217 Query: 680 PXPPPPG---PPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPP 850 PPP G P P P Sbjct: 218 YTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKVI 277 Query: 851 XPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP P PPP P PP P P Sbjct: 278 YTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 313 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 513 PXPSXXXXPPPXPPX------PPPXPXAPXXXXXPXPPPAPPPPXXXP--PXPPP 653 P PPP PP PPP P P PPP P P PPP Sbjct: 159 PTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 213 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 7/58 (12%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPP-------PAPPPPXXXPPXPPPPXXP 665 P P+ P P PP P PP P PPPP PPP P Sbjct: 141 PPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPP 198 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAP 617 PPP PP P P P PPP P Sbjct: 382 PPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 P P P+ PP PPP P P PPPP Sbjct: 366 PVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPP 407 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 P PP PP P PP PPPP Sbjct: 381 PPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPP 623 PP PP P P PPP PPP Sbjct: 381 PPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 29.1 bits (62), Expect = 9.5 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPP--PAPPPP----XXXPPXPPPP 656 P P+ P PPP P PP PPP PP PPPP Sbjct: 355 PPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 >AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA protein. Length = 1215 Score = 46.0 bits (104), Expect = 8e-05 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GGPGG G GG G G G G GG G G G Sbjct: 887 GGGPGGAGPSGGGPGGAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGG 946 Query: 558 GGAGXGGGXXPXXGGAXXGG 499 GG G GG GG Sbjct: 947 GGGGGPGGRGRWSDDEDEGG 966 Score = 40.7 bits (91), Expect = 0.003 Identities = 30/106 (28%), Positives = 30/106 (28%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGGXXXXXXXXXX 783 GAG G GG G G G GG GGG G GGGGGG Sbjct: 902 GAGTGGGGPGGRQQGPGFFNPRNPFNDNQRG-RGGQSGGGVRGVGGGGGGGPGGRGRWSD 960 Query: 782 XXXXXXXXXGXXGGPGXGXGXXXXXXXXXXXXXXXXXGXGXXGRGG 645 GGPG G GRGG Sbjct: 961 DEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNNSRGGRGG 1006 Score = 39.9 bits (89), Expect = 0.005 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 8/95 (8%) Frame = +2 Query: 503 PXXAPPXXGXXPP--------PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAX 658 P PP G PP P P P P P P PPP Sbjct: 575 PVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPMM 634 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P G P P PP P P P Sbjct: 635 MPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVP 669 Score = 37.5 bits (83), Expect = 0.027 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P P PPP P P P P P PP P P P Sbjct: 567 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPT 626 Query: 683 XPPPPGPPXXPPXXPPXXPXPXXXPXPXA 769 PP P PP P P P A Sbjct: 627 TNMPPPMMMPPTMMPPGFPGIGGPPHPMA 655 Score = 34.3 bits (75), Expect = 0.25 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 5/113 (4%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGX-GAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 G G G G GGG G G G G GG G G GG Sbjct: 872 GNGGNGVGPMFMRNQGGGPGGAGPSGGGPGG-AGTGGGG-----PGGRQQGPGFFNPRNP 925 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAG----GGXGG 634 G G G G G GG GGPGG G G GG GG Sbjct: 926 FNDNQRGRGGQSGGGVR-GVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGG 977 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 G G G G G G G G G G G GG G GG Sbjct: 872 GNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGG 912 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 705 GGPGG-GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GGP G GG G GGG GG G G G G G G G Sbjct: 868 GGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGGRQQGPG 918 Score = 31.5 bits (68), Expect = 1.8 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP---PPAXPXPX 670 PP PP PPP P P PP P PP P PP P P Sbjct: 609 PPIMMPPT--NMPPPMMMP--TTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFP- 663 Query: 671 XXPPXPPPPGP 703 P PPP P Sbjct: 664 -PPGAVPPPIP 673 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P+ PP P P P P P PP PP PP P Sbjct: 619 PPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 673 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG G G G G G GG GGG GG Sbjct: 869 GPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPGG 912 Score = 29.9 bits (64), Expect = 5.5 Identities = 28/108 (25%), Positives = 28/108 (25%), Gaps = 3/108 (2%) Frame = +2 Query: 644 PPPAXPX-PXXXPPXP--PPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PPP P P PP P PPPG P P P P Sbjct: 567 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAP-PMGINMPPPIMMPPTNMPPPMMMP 625 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PP P P P P Sbjct: 626 TTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPPPGAVPPPIP 673 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GG G GGG G G G G GG G G Sbjct: 869 GPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPG 911 Score = 29.5 bits (63), Expect = 7.2 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 7/53 (13%) Frame = +1 Query: 820 PPPPXPXXP--PPPXPPXPPPXXXXXXXXXXXXXXP-----XPPXPXPPAPXP 957 PPP P P PPP P PPP P PP PP P Sbjct: 567 PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMP 619 >X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. Length = 196 Score = 45.6 bits (103), Expect = 1e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG GG G GGGG GG G GGG G G G GG Sbjct: 51 AGGLGGGLGGGL-GGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 Query: 588 XGXG 577 G Sbjct: 110 YSGG 113 Score = 43.6 bits (98), Expect = 4e-04 Identities = 26/60 (43%), Positives = 27/60 (45%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG GGG GG G G GG GG G G GG G G G G +G GG Sbjct: 52 GGLGGGL-GGGLGGLSGGLGGKLGGGGGGGGYSGGYSNG-GGYSGGGGYSGGGGYSGGGG 109 Score = 42.3 bits (95), Expect = 0.001 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGX--AGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXG 541 G GG GGG GG G G GGG GG G G G G GG G Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYS 111 Query: 540 GG 535 GG Sbjct: 112 GG 113 Score = 41.9 bits (94), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG GG GGGG GG G G GGG G GG Sbjct: 60 GGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = -3 Query: 729 GGXXGGXXGGPGG--GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXG 556 GG GG GG GG GG GG G GGG GG G GG G G G Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGG----GGGGGG-----YSGGYSNGGGYSGGGGYSGGG 102 Query: 555 GAGXGGG 535 G GGG Sbjct: 103 GYSGGGG 109 Score = 40.3 bits (90), Expect = 0.004 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GG GG G G GG GG G G G GG G G GG G GG G Sbjct: 52 GGLGGGLGGGLGGLSGGLGG----KLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGG 107 Query: 516 GAXXGG 499 G GG Sbjct: 108 GGYSGG 113 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 G GGGG G GGG GG G G G GG GG Sbjct: 75 GGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G GG GG G GG G GGGG G GG GG Sbjct: 64 GLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 654 AGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 AGG GG G G GG G G G G GG GG GG Sbjct: 51 AGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 32.7 bits (71), Expect = 0.77 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGG--GGGG 813 A AGG G G G GGG GG GG GG GGGG Sbjct: 47 AAEQAGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 97 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 962 GAGXGAGGX--GXGGX-GXXXXXXXXXXXXRXGGGXGGXGG-GGXXGXGGGGG 816 G G G GG G GG G GGG G GG G G GGGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGG 109 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G GGGG GGG G G G GGG G GGG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 GG GG GG GGGG GG G G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GGGG GG G G G G G Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRG 92 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGG G Sbjct: 69 GGGGGGGGGGGGGGGGGGGSG 89 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXG 578 G GGGG GG GGGG GGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGG 93 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 G R G G GGGG G G G G GG G G G Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 RG G GGGG G G G G GG G G G Sbjct: 55 RGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSG 89 Score = 35.9 bits (79), Expect = 0.083 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGG 540 G G G G GG GG G G G GG RGGG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G+ G GG G GGG GG GGGG G G GGG Sbjct: 56 GNGWGSSSWGGGGGGGGG-----------GGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 G G G G G GGG GG G G G G G G Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 G G GG GGGG G G G G GG G G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 696 GGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 GGGG GG G G GGG GG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 32.7 bits (71), Expect = 0.77 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 610 GGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G G GGG GG GGG G G Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRG 92 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG G GG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 31.1 bits (67), Expect = 2.4 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G G G G G GGG GG G G G GG G G G Sbjct: 45 GNDSNGDNSRRGNGWGSSSWGGGGGGGGGGGG------GGGGGGGGGGGSGYRGGGLRPN 98 Query: 549 GXGGGXXPXXGGAXXGG 499 G P GG Sbjct: 99 RRIGRIPPPSQSCNAGG 115 >AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p protein. Length = 174 Score = 45.6 bits (103), Expect = 1e-04 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG G PG GG G G G GGG G G G G GG G G G G GG Sbjct: 36 GGLGGRPGFGGGPGFGGGPGF-GGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGG 94 Query: 537 G 535 G Sbjct: 95 G 95 Score = 38.7 bits (86), Expect = 0.012 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXX--GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 G G G G G GG GGPG GG G G G GGG G G G GG Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGF-GGGPGFGGGQGFGGRPGFGGG 95 Query: 588 XG 583 G Sbjct: 96 PG 97 Score = 36.7 bits (81), Expect = 0.048 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G GG GGG G G G G G GGG G GGG G G Sbjct: 43 GFGGGPGFGGGPGFGGGPGFG-GRPGFGGGPGFGGGPG-FGGGQGFGGRPGFGGG 95 Score = 35.1 bits (77), Expect = 0.15 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G G GG GGG G G G G G GGG G GGG G G Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFG-GRPGFGGGPG-FGGGPGFGGGQG 85 Score = 30.3 bits (65), Expect = 4.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXG 551 G G G GG GGG G G G G G GGG G Sbjct: 61 GFGGRPGFGGGPGFGGGPGFGGGQGFG-GRPGFGGGPG 97 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 45.6 bits (103), Expect = 1e-04 Identities = 25/56 (44%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Frame = +3 Query: 513 PXPSXXXXPPPXPP----XPPPXPXAPXXXXXPXPPPA----PPPPXXXPPXPPPP 656 P PS PPP PP PPP P P P PPP+ PPPP PPPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPP--PSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 491 Score = 41.9 bits (94), Expect = 0.001 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 5/76 (6%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P +P PPP P+ P P P P PP PPP P P PP Sbjct: 599 PLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPA-FVHQKQFGPPGPPPP-PEPQYLPP 656 Query: 683 XPP-----PPGPPXXP 715 PP P GPP P Sbjct: 657 PPPLANVRPLGPPPPP 672 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 3/77 (3%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP---GPP 706 P P PP PP P P P P P P P P PPP GPP Sbjct: 110 PKPFYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPP 169 Query: 707 XXPPXXPPXXPXPXXXP 757 PP P P P Sbjct: 170 --PPLKIQHRPAPQYGP 184 Score = 39.1 bits (87), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 4/90 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP--APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP P G P P P PP P P P P P P P Sbjct: 130 PPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQY 189 Query: 674 XPPXPPP--PGPPXXPPXXPPXXPXPXXXP 757 PP PP P P P P P P Sbjct: 190 GPPPPPQLLPSPHAAPLFKPAHQPATSYGP 219 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP G PP P P P P P P PP PP P PPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP------PPP 491 Query: 695 PGPPXXPPXXPP 730 P PP PP Sbjct: 492 PSGNYGPP--PP 501 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 9/66 (13%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPX----PXPXPXXXXXXPPXPPPAXPXPXXXP-----PXPPPPG 700 P PP P P PP P P P PP PP P P P PPP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Query: 701 PPXXPP 718 PP Sbjct: 495 NYGPPP 500 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP---XPPPP 656 P P+ PPP P P P PPP P P PP PPPP Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 7/58 (12%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXP---XPPXPP----XPXPXXXXXXXPPSPP 651 PP P P PPPP P P P PP PP P P PP PP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 PPP PP P P PPP PP PP PP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 37.1 bits (82), Expect = 0.036 Identities = 33/141 (23%), Positives = 33/141 (23%), Gaps = 5/141 (3%) Frame = +2 Query: 503 PXXAPPXXGXXP-----PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P PP P PP P P P P P P PP P P Sbjct: 112 PFYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 P P P PP P P P P A P Sbjct: 172 LKIQHRPAPQYGPPKLQYGPP--PPPQLLPSPHAAPLFKPAHQPATSYGPPASGPLNLPP 229 Query: 848 PXPXPXXPPXPAPXPXPAXPP 910 PP P P P P Sbjct: 230 KQIFDAPPPNYGPPPLPVSLP 250 Score = 37.1 bits (82), Expect = 0.036 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP AP P P P P PP P P P PP PP A P P Sbjct: 612 PPPSAPQLSLQQQLPAPQP-GPAFVHQKQFGPPGPPPPPEPQYLPPP-PPLANVRPLGPP 669 Query: 680 PXPPPPGPPXXP 715 P P P P Sbjct: 670 PPPTQQYLPAAP 681 Score = 36.7 bits (81), Expect = 0.048 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 4/92 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP---PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 P PP P A P P P PP P P PA Sbjct: 579 PQTYIPPAANEIPVSGSATQPLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPAFVHQK 638 Query: 671 XX-PPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP P P PP P P Sbjct: 639 QFGPPGPPPPPEPQYLPPPPPLANVRPLGPPP 670 Score = 36.3 bits (80), Expect = 0.063 Identities = 35/129 (27%), Positives = 35/129 (27%), Gaps = 1/129 (0%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P PP P PA P P PP P P P PP P P P Sbjct: 110 PKPFYGPPHIQHKPAQQYGPPPPKPA---PQYGP--PPQPAPQYGP---PPPKPAPQYGP 161 Query: 758 XPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP-PXPAPXPXPAXPPPPXXXXXP 934 P PP P P P AP PA P P Sbjct: 162 PPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLPSPHAAPLFKPAH-QPATSYGPP 220 Query: 935 PXPPRPXPP 961 P PP Sbjct: 221 ASGPLNLPP 229 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPP---GPPXXPP---XXPPXXPXPXXXPXP 763 PPP P PP PPP GPP PP PP P P P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPP 480 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXX---PPXPAPXPXPAXPPPPXXXXXPPXPPR----PXPP 961 PP P P PP P P PPPP PP PP P PP Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 491 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPP----XPXPXXXXXXXP 639 P PP P P PPPP P P P PP PP P P P Sbjct: 439 PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP 498 Query: 640 PSP 648 P P Sbjct: 499 PPP 501 Score = 35.1 bits (77), Expect = 0.15 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPA----PPPPXXXPPXPPPP 656 P P + PPP P P P P PPP+ PPPP PPPP Sbjct: 447 PPPPPSGNYG-PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPP P P PPP PPP P PP P Sbjct: 150 PPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPP 195 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPR----PXPP 961 PP P P P P PPPP PP PP P PP Sbjct: 459 PPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPX 733 PP P P P P P P PP PP P P P PP PP Sbjct: 435 PPPPP---PSGNYGP-PPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Query: 734 XPXPXXXPXP 763 P P P Sbjct: 491 PPSGNYGPPP 500 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPPP PPP PP P P P P P+ Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPS 483 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP------PXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP P P PP P PP P P Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP-------PXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP P P PP P PP P P Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 537 PPPXPPXPPP---XPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PP PP P P P P P PP PP P P P Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 869 PPXPAPXPXPA--XPPPPXXXXXPPXPPRP 952 PP P P P P PPPP P PP P Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGPPPP 671 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPP P P PPP P P P P PP P Sbjct: 129 PPPPKPAPQYGPPPQPA---PQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 30.7 bits (66), Expect = 3.1 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 7/86 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-PXPPPAXPXPXXXPPXP-PPPG 700 G P P P P P P P PPP+ P P P PG Sbjct: 572 GVKPQQQPQTYIPPAANEIPVSGSATQPLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPG 631 Query: 701 P-----PXXPPXXPPXXPXPXXXPXP 763 P P PP P P P P Sbjct: 632 PAFVHQKQFGPPGPPPPPEPQYLPPP 657 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Frame = +1 Query: 817 PPPPPXPXXPPPPXP--------PXPPP 876 PPPPP P PPP P P PPP Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP P PP P P PPPP P P Sbjct: 648 PPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAP 681 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P+ PP P P PP P P P Sbjct: 646 PPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPP 651 P PPP PP P P P P P PS P Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 45.6 bits (103), Expect = 1e-04 Identities = 25/56 (44%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Frame = +3 Query: 513 PXPSXXXXPPPXPP----XPPPXPXAPXXXXXPXPPPA----PPPPXXXPPXPPPP 656 P PS PPP PP PPP P P P PPP+ PPPP PPPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPP--PSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 491 Score = 41.9 bits (94), Expect = 0.001 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 5/76 (6%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P +P PPP P+ P P P P PP PPP P P PP Sbjct: 599 PLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPA-FVHQKQFGPPGPPPP-PEPQYLPP 656 Query: 683 XPP-----PPGPPXXP 715 PP P GPP P Sbjct: 657 PPPLANVRPLGPPPPP 672 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 3/77 (3%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP---GPP 706 P P PP PP P P P P P P P P PPP GPP Sbjct: 110 PKPFYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPP 169 Query: 707 XXPPXXPPXXPXPXXXP 757 PP P P P Sbjct: 170 --PPLKIQHRPAPQYGP 184 Score = 39.1 bits (87), Expect = 0.009 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 4/90 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP--APPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP P G P P P PP P P P P P P P Sbjct: 130 PPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQY 189 Query: 674 XPPXPPP--PGPPXXPPXXPPXXPXPXXXP 757 PP PP P P P P P P Sbjct: 190 GPPPPPQLLPSPHAAPLFKPAHQPATSYGP 219 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP G PP P P P P P P PP PP P PPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP------PPP 491 Query: 695 PGPPXXPPXXPP 730 P PP PP Sbjct: 492 PSGNYGPP--PP 501 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 9/66 (13%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPX----PXPXPXXXXXXPPXPPPAXPXPXXXP-----PXPPPPG 700 P PP P P PP P P P PP PP P P P PPP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Query: 701 PPXXPP 718 PP Sbjct: 495 NYGPPP 500 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP---XPPPP 656 P P+ PPP P P P PPP P P PP PPPP Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 7/58 (12%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXP---XPPXPP----XPXPXXXXXXXPPSPP 651 PP P P PPPP P P P PP PP P P PP PP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 PPP PP P P PPP PP PP PP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 37.1 bits (82), Expect = 0.036 Identities = 33/141 (23%), Positives = 33/141 (23%), Gaps = 5/141 (3%) Frame = +2 Query: 503 PXXAPPXXGXXP-----PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXP 667 P PP P PP P P P P P P PP P P Sbjct: 112 PFYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Query: 668 XXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 P P P PP P P P P A P Sbjct: 172 LKIQHRPAPQYGPPKLQYGPP--PPPQLLPSPHAAPLFKPAHQPATSYGPPASGPLNLPP 229 Query: 848 PXPXPXXPPXPAPXPXPAXPP 910 PP P P P P Sbjct: 230 KQIFDAPPPNYGPPPLPVSLP 250 Score = 37.1 bits (82), Expect = 0.036 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP AP P P P P PP P P P PP PP A P P Sbjct: 612 PPPSAPQLSLQQQLPAPQP-GPAFVHQKQFGPPGPPPPPEPQYLPPP-PPLANVRPLGPP 669 Query: 680 PXPPPPGPPXXP 715 P P P P Sbjct: 670 PPPTQQYLPAAP 681 Score = 36.7 bits (81), Expect = 0.048 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 4/92 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAP---PXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 P PP P A P P P PP P P PA Sbjct: 579 PQTYIPPAANEIPVSGSATQPLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPGPAFVHQK 638 Query: 671 XX-PPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPPP P P PP P P Sbjct: 639 QFGPPGPPPPPEPQYLPPPPPLANVRPLGPPP 670 Score = 36.3 bits (80), Expect = 0.063 Identities = 35/129 (27%), Positives = 35/129 (27%), Gaps = 1/129 (0%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P PP P PA P P PP P P P PP P P P Sbjct: 110 PKPFYGPPHIQHKPAQQYGPPPPKPA---PQYGP--PPQPAPQYGP---PPPKPAPQYGP 161 Query: 758 XPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP-PXPAPXPXPAXPPPPXXXXXP 934 P PP P P P AP PA P P Sbjct: 162 PPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLPSPHAAPLFKPAH-QPATSYGPP 220 Query: 935 PXPPRPXPP 961 P PP Sbjct: 221 ASGPLNLPP 229 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +2 Query: 644 PPPAXPXPXXXPPXPPPP---GPPXXPP---XXPPXXPXPXXXPXP 763 PPP P PP PPP GPP PP PP P P P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPP 480 Score = 35.9 bits (79), Expect = 0.083 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 845 PPXPXPXX---PPXPAPXPXPAXPPPPXXXXXPPXPPR----PXPP 961 PP P P PP P P PPPP PP PP P PP Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 491 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXP--XPPXPP----XPXPXXXXXXXP 639 P PP P P PPPP P P P PP PP P P P Sbjct: 439 PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGP 498 Query: 640 PSP 648 P P Sbjct: 499 PPP 501 Score = 35.1 bits (77), Expect = 0.15 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPA----PPPPXXXPPXPPPP 656 P P + PPP P P P P PPP+ PPPP PPPP Sbjct: 447 PPPPPSGNYG-PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPP P P PPP PPP P PP P Sbjct: 150 PPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPP 195 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPR----PXPP 961 PP P P P P PPPP PP PP P PP Sbjct: 459 PPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPX 733 PP P P P P P P PP PP P P P PP PP Sbjct: 435 PPPPP---PSGNYGP-PPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Query: 734 XPXPXXXPXP 763 P P P Sbjct: 491 PPSGNYGPPP 500 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPPP PPP PP P P P P P+ Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPS 483 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP------PXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP P P PP P PP P P Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP-------PXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PPPP P P PP P PP P P Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 490 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 537 PPPXPPXPPP---XPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PP PP P P P P P PP PP P P P Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 869 PPXPAPXPXPA--XPPPPXXXXXPPXPPRP 952 PP P P P P PPPP P PP P Sbjct: 642 PPGPPPPPEPQYLPPPPPLANVRPLGPPPP 671 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPP P P PPP P P P P PP P Sbjct: 129 PPPPKPAPQYGPPPQPA---PQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 30.7 bits (66), Expect = 3.1 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 7/86 (8%) Frame = +2 Query: 527 GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-PXPPPAXPXPXXXPPXP-PPPG 700 G P P P P P P P PPP+ P P P PG Sbjct: 572 GVKPQQQPQTYIPPAANEIPVSGSATQPLPSPQALYQPPPPPPSAPQLSLQQQLPAPQPG 631 Query: 701 P-----PXXPPXXPPXXPXPXXXPXP 763 P P PP P P P P Sbjct: 632 PAFVHQKQFGPPGPPPPPEPQYLPPP 657 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 8/28 (28%) Frame = +1 Query: 817 PPPPPXPXXPPPPXP--------PXPPP 876 PPPPP P PPP P P PPP Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP P PP P P PPPP P P Sbjct: 648 PPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAP 681 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P+ PP P P PP P P P Sbjct: 646 PPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPP 651 P PPP PP P P P P P PS P Sbjct: 645 PPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 45.6 bits (103), Expect = 1e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G GGGG GGG G G G GGG G GGG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGG 85 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGG 86 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGG 87 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 GG GG GG GGGG GG G G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GGGG GG G G G G G Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRG 92 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGG G Sbjct: 69 GGGGGGGGGGGGGGGGGGGSG 89 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXG 578 G GGGG GG GGGG GGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGG 93 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 G R G G GGGG G G G G GG G G G Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 948 RGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 RG G GGGG G G G G GG G G G Sbjct: 55 RGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSG 89 Score = 35.9 bits (79), Expect = 0.083 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 656 GRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGG 540 G G G G GG GG G G G GG RGGG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G G G+ G GG G GGG GG GGGG G G GGG Sbjct: 56 GNGWGSSSWGGGGGGGGG-----------GGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 G G G G G GGG GG G G G G G G Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 G G GG GGGG G G G G GG G G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 696 GGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 GGGG GG G G GGG GG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 32.7 bits (71), Expect = 0.77 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 610 GGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G G GGG GG GGG G G Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRG 92 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G GG G GGG G GG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 31.1 bits (67), Expect = 2.4 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 G G G G G G GGG GG G G G GG G G G Sbjct: 45 GNDSNGDNSRRGNGWGSSSWGGGGGGGGGGGG------GGGGGGGGGGGSGYRGGGLRPN 98 Query: 549 GXGGGXXPXXGGAXXGG 499 G P GG Sbjct: 99 RRIGRIPPPSQSCNAGG 115 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 45.6 bits (103), Expect = 1e-04 Identities = 36/139 (25%), Positives = 36/139 (25%), Gaps = 6/139 (4%) Frame = +2 Query: 548 PAPPXPXXXX-PXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P P P P P P P P P P P P PP PP Sbjct: 18990 PIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPV 19049 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPP----XPAPX 889 P P P P P P P P AP Sbjct: 19050 FIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQ 19109 Query: 890 PXPAXPPPPXXXXXPPXPP 946 P P PP P PP Sbjct: 19110 PVHPAPNPPVHEFNYPTPP 19128 Score = 34.7 bits (76), Expect = 0.19 Identities = 37/145 (25%), Positives = 40/145 (27%), Gaps = 5/145 (3%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA-XPXPXXXPPXPPPPGPPXXP 715 PP P+ P P P P P P P PA P P P P P P Sbjct: 19270 PPPPSRPG-VINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNP 19328 Query: 716 PXXPPXXPXP-XXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPP--XPXPXXPPXPA- 883 P P P P P PP P P P+ Sbjct: 19329 PIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSI 19388 Query: 884 PXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P P+P P Sbjct: 19389 PQPTPQRPSP--GIINVPSVPQPIP 19411 Score = 34.3 bits (75), Expect = 0.25 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 3/89 (3%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPX---PXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP P P PAP P P P P P P P P Sbjct: 19043 PPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVV 19102 Query: 671 XXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P P PP P P P Sbjct: 19103 NIPSAPQPVHPAPNPPVHEFNYPTPPAVP 19131 Score = 31.1 bits (67), Expect = 2.4 Identities = 34/148 (22%), Positives = 36/148 (24%), Gaps = 9/148 (6%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P+ P P P P P P P P P P P P P Sbjct: 19004 PSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKP 19063 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP-PXPA----- 883 P P + P P P P P P Sbjct: 19064 GVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFN 19123 Query: 884 -PXPXPAXPPPPXXXXXP--PXPPRPXP 958 P P PA P P P P P P P Sbjct: 19124 YPTP-PAVPQQPGVLNIPSYPTPVAPTP 19150 Score = 31.1 bits (67), Expect = 2.4 Identities = 29/126 (23%), Positives = 29/126 (23%), Gaps = 1/126 (0%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P PAP P P P P P P P P P P P Sbjct: 19110 PVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPS 19169 Query: 719 -XXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPX 895 P P P P P A P P P P P Sbjct: 19170 VINVPSVPQP-AYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPS 19228 Query: 896 PAXPPP 913 P P P Sbjct: 19229 PVHPTP 19234 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 543 PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP P P PPP P P P P P P Sbjct: 15039 PSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGP 15079 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 4/59 (6%) Frame = +3 Query: 501 PXXXPXPSXXXXP----PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P P P PP P PPP P P PP P P Sbjct: 19232 PTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYP 19290 Score = 29.9 bits (64), Expect = 5.5 Identities = 36/155 (23%), Positives = 37/155 (23%), Gaps = 2/155 (1%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP-PXPXPXXXXXXXPPSPPRPXXPXXX 675 PP P P PP P P P P P P P P PS P+P P Sbjct: 19271 PPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNI---PSVPQPTYP--- 19324 Query: 676 XXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPP 855 P P P P P P P P Sbjct: 19325 ---HRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPG 19381 Query: 856 XPPXPP-PXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 P P P P P P AP P Sbjct: 19382 IVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSP 19416 Score = 29.5 bits (63), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P P P P P Sbjct: 12400 PPPPPPGPKDEPVRRPCQPSP 12420 Score = 29.1 bits (62), Expect = 9.5 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPX-PXXXXXXPPX--PPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P P P P P P P P P P P PP Sbjct: 18955 PTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPP 19014 Query: 719 XXPPXXPXPXXXPXP 763 P P P P Sbjct: 19015 VNYPTQPSPQIPVQP 19029 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA---PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP PP G PP PA PP P P PP P P PP PPP P Sbjct: 294 PPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPG-MPAP------PPRPPPTNWRP- 345 Query: 671 XXPPXPPPPGPPXXP 715 PP P PP P P Sbjct: 346 --PPVPFPPTPYARP 358 Score = 44.8 bits (101), Expect = 2e-04 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPX------PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP---XP 688 PPP APP P PP P P P PP PP PP P Sbjct: 256 PPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIP 315 Query: 689 PPPGPPXXPPXXPPXXPXPXXXPXP 763 PPP PP P P P P Sbjct: 316 PPPRMMQPNAWAPPGMPAPPPRPPP 340 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 4/92 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA---XPXPX 670 PP P P PP P P P P P P P PP PP A P P Sbjct: 263 PPPVVPVSNNNMGMLAPPPPVPQPA-PFPATIPPP-PLPPMTGGQPPLPP-AMGIPPPPR 319 Query: 671 XXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPG P PP PP P P P Sbjct: 320 MMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFP 351 Score = 44.0 bits (99), Expect = 3e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P P P P PP P PPP P P P PP P Sbjct: 280 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPP 339 Query: 716 P--XXPPXXPXPXXXPXPXA 769 P PP P P P P A Sbjct: 340 PTNWRPPPVPFP---PTPYA 356 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P PP P PP P P P P P PP P P P Sbjct: 281 PPVPQPAPFPATIPPPPLPPMTGGQPPLP--PAMGIPPPPRMMQPNAWAPPGMPAP---P 335 Query: 680 PXPPPPGPPXXPPXXPP 730 P PPP P PP Sbjct: 336 PRPPPTNWRPPPVPFPP 352 Score = 38.3 bits (85), Expect = 0.016 Identities = 33/123 (26%), Positives = 33/123 (26%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAX 772 P P P PP P P P G PP P P P P P Sbjct: 240 PQMPGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 299 Query: 773 XXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P AP PA PP P P PP P Sbjct: 300 PMTGGQPPLPPAMGI---------PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRP-PPVP 349 Query: 953 XPP 961 PP Sbjct: 350 FPP 352 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX-PP 691 P G P P P P PP P PPP P P P PP Sbjct: 240 PQMPGQIPAQMPGQMMP----PPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPP 295 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PP PP PP P P P PP P P P Sbjct: 296 PPLPP-MTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 354 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP P PP P + PPP P P P PPP P Sbjct: 251 PGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 299 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXP-------XPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXX 636 P PP P P PPPPR P P P PP P P Sbjct: 288 PFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPP 347 Query: 637 PPSPPRP 657 P PP P Sbjct: 348 VPFPPTP 354 Score = 32.3 bits (70), Expect = 1.0 Identities = 26/115 (22%), Positives = 27/115 (23%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P P + P P PP P P P PP P Sbjct: 243 PGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMT 302 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PPP PP PPP P P P Sbjct: 303 GGQPPLP---PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 354 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP-PPXXXXXXXXXXXXXXPXPPXPXPP 945 PPPP P P P PP P PP P PP P Sbjct: 279 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQP 323 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPP-PPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PP PP PP PP PPP P PP PP Sbjct: 296 PPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 340 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA---PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP PP G PP PA PP P P PP P P PP PPP P Sbjct: 275 PPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPG-MPAP------PPRPPPTNWRP- 326 Query: 671 XXPPXPPPPGPPXXP 715 PP P PP P P Sbjct: 327 --PPVPFPPTPYARP 339 Score = 44.8 bits (101), Expect = 2e-04 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPX------PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP---XP 688 PPP APP P PP P P P PP PP PP P Sbjct: 237 PPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIP 296 Query: 689 PPPGPPXXPPXXPPXXPXPXXXPXP 763 PPP PP P P P P Sbjct: 297 PPPRMMQPNAWAPPGMPAPPPRPPP 321 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 4/92 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA---XPXPX 670 PP P P PP P P P P P P P PP PP A P P Sbjct: 244 PPPVVPVSNNNMGMLAPPPPVPQPA-PFPATIPPP-PLPPMTGGQPPLPP-AMGIPPPPR 300 Query: 671 XXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPG P PP PP P P P Sbjct: 301 MMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFP 332 Score = 44.0 bits (99), Expect = 3e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P P P P PP P PPP P P P PP P Sbjct: 261 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPP 320 Query: 716 P--XXPPXXPXPXXXPXPXA 769 P PP P P P P A Sbjct: 321 PTNWRPPPVPFP---PTPYA 337 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P PP P PP P P P P P PP P P P Sbjct: 262 PPVPQPAPFPATIPPPPLPPMTGGQPPLP--PAMGIPPPPRMMQPNAWAPPGMPAP---P 316 Query: 680 PXPPPPGPPXXPPXXPP 730 P PPP P PP Sbjct: 317 PRPPPTNWRPPPVPFPP 333 Score = 38.3 bits (85), Expect = 0.016 Identities = 33/123 (26%), Positives = 33/123 (26%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAX 772 P P P PP P P P G PP P P P P P Sbjct: 221 PQMPGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 280 Query: 773 XXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P AP PA PP P P PP P Sbjct: 281 PMTGGQPPLPPAMGI---------PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRP-PPVP 330 Query: 953 XPP 961 PP Sbjct: 331 FPP 333 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX-PP 691 P G P P P P PP P PPP P P P PP Sbjct: 221 PQMPGQIPAQMPGQMMP----PPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPP 276 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PP PP PP P P P PP P P P Sbjct: 277 PPLPP-MTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP P PP P + PPP P P P PPP P Sbjct: 232 PGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 280 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXP-------XPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXX 636 P PP P P PPPPR P P P PP P P Sbjct: 269 PFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPP 328 Query: 637 PPSPPRP 657 P PP P Sbjct: 329 VPFPPTP 335 Score = 32.3 bits (70), Expect = 1.0 Identities = 26/115 (22%), Positives = 27/115 (23%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P P + P P PP P P P PP P Sbjct: 224 PGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMT 283 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PPP PP PPP P P P Sbjct: 284 GGQPPLP---PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP-PPXXXXXXXXXXXXXXPXPPXPXPP 945 PPPP P P P PP P PP P PP P Sbjct: 260 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQP 304 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPP-PPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PP PP PP PP PPP P PP PP Sbjct: 277 PPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 321 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 45.2 bits (102), Expect = 1e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 7/87 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP-----APPXPXXXXPXPXXPPXPXPX--PXXXXXXPPXPPPAX 658 PP P PPP P APP P P P P P P P PP Sbjct: 158 PPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGG 217 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P PPP G P PP P Sbjct: 218 VMVMPSPTPPPPAGGVLVMPRPPPPPP 244 Score = 42.7 bits (96), Expect = 7e-04 Identities = 28/108 (25%), Positives = 28/108 (25%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP PP P P PPP P PP P P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPF-PDRPPAYTPTPDPMP 213 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P PP PP PP P Sbjct: 214 PVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTP 261 Score = 42.3 bits (95), Expect = 0.001 Identities = 31/115 (26%), Positives = 32/115 (27%), Gaps = 1/115 (0%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P PPPP P P PP PP +PP P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPP-----------AMAPPLPAKPYPYPDLAAMPFPDRP 202 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXP-PPPPPXPXXPPPPXPPXPP 873 P P P PP P PPPPP P PP PP Sbjct: 203 PAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 41.9 bits (94), Expect = 0.001 Identities = 30/98 (30%), Positives = 31/98 (31%), Gaps = 10/98 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX----PXPXPXXXXXX----PPXPPPA 655 PP +PP P P P P P PP P P P P PPPA Sbjct: 171 PPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPA 230 Query: 656 XPX--PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP G P PP P P Sbjct: 231 GGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPAEVAPPP 268 Score = 38.3 bits (85), Expect = 0.016 Identities = 32/126 (25%), Positives = 32/126 (25%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P PP PPA P P P P P PP P P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAY-TPTPDPMP 213 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P PP PA PPPP P Sbjct: 214 PVGGVMVMPSPTPPPPAGGVLV-------MPRPPPPPPPAGGVLVMPPPPPSFTPAEVAP 266 Query: 944 PRPXPP 961 P P Sbjct: 267 PPSFVP 272 Score = 36.7 bits (81), Expect = 0.048 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 13/90 (14%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXP--XPXXPPXPXPXPXXXXXXPPXPPPA-XPXPXXXP-- 679 PP P P P P P P P P P P P PPA P P P Sbjct: 156 PPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPV 215 Query: 680 --------PXPPPPGPPXXPPXXPPXXPXP 745 P PPPP PP P P Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPP 245 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPP---PPXXXPPXPPP 653 PP PPP P PPP+PP PP P P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 Score = 35.1 bits (77), Expect = 0.15 Identities = 33/133 (24%), Positives = 34/133 (25%), Gaps = 4/133 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PPP PP P P PP P P P + P P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPP----PPSP-PAMAPPLPAKPYPYPDL----AAMPFP 199 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP--- 828 P P P P PP PPPP Sbjct: 200 DRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSF 259 Query: 829 -PXPXXPPPPXPP 864 P PPP P Sbjct: 260 TPAEVAPPPSFVP 272 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 558 PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PPP P PPP P PP PP P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKP 187 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P P P PP PP P PP PPPA P PPP P Sbjct: 207 PTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGV--LVMPPPPPSFTPAEV 264 Query: 716 PXXPPXXP 739 P P Sbjct: 265 APPPSFVP 272 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPP PP P +P P Sbjct: 154 PPPPPPLEEPEKCPLSPP--PPPSPPAMAPPLPAKPYP 189 >BT001672-1|AAN71427.1| 315|Drosophila melanogaster RE50346p protein. Length = 315 Score = 45.2 bits (102), Expect = 1e-04 Identities = 32/122 (26%), Positives = 32/122 (26%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 36 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 95 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G G GG G GG GG GG G GGG G G Sbjct: 96 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSGFGGNSGNFGQA 153 Query: 600 XG 595 G Sbjct: 154 QG 155 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 39 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 98 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 99 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 132 Score = 38.3 bits (85), Expect = 0.016 Identities = 39/147 (26%), Positives = 39/147 (26%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G GGG G GG G G Sbjct: 32 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 91 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGX 598 G G G G G GG G GGG AGG GG G G G Sbjct: 92 WANGGG-GDVDGFGNNAGGAGGFAGNSFGGG----------AGGPFGGGSFGNNGFGGGP 140 Query: 597 GGXXGXGXXXXGXGGAGXGGGXXPXXG 517 G G G G G P G Sbjct: 141 SGFGGNS----GNFGQAQGTNSLPSLG 163 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 104 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSGFGGNSGNFGQAQGTNSLPSL 162 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 163 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 222 Query: 603 G 601 G Sbjct: 223 G 223 Score = 36.7 bits (81), Expect = 0.048 Identities = 34/119 (28%), Positives = 34/119 (28%), Gaps = 2/119 (1%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 32 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 89 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXG-XGGGXGGXGGGXXXXXGXGXXXG 500 GGGG G GGAGG G GA G GGG G G G G G Sbjct: 90 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSGFGGNSG 148 Score = 36.3 bits (80), Expect = 0.063 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 2/123 (1%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 32 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 91 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXGXGXGGXXGRGGGGXGXXX 522 G G GG GG G GG G G G G G GGG G Sbjct: 92 WANGGGGDVDGFG-NNAGGAGG-----FAGNSFGGGAGGPFGGGSFGNNGFGGGPSGFGG 145 Query: 521 XXG 513 G Sbjct: 146 NSG 148 Score = 34.7 bits (76), Expect = 0.19 Identities = 36/138 (26%), Positives = 36/138 (26%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G G G G G G G GG G GG Sbjct: 12 GGYGTGS-GSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGG 70 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 A G G G GGG G G AGG G G G Sbjct: 71 A---AGGAVAGAGMGQRDNPFINPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFG 127 Query: 600 XG--GXXGXGXXXXGXGG 553 G G G G G GG Sbjct: 128 GGSFGNNGFGGGPSGFGG 145 Score = 32.7 bits (71), Expect = 0.77 Identities = 30/110 (27%), Positives = 32/110 (29%), Gaps = 1/110 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXG-GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG G GGG +G G +G G G Sbjct: 120 GGAGGPFGGGSFGNNGFGGGPSGFGGNSGNFGQ-AQGTNSLPSLGSFSQNQGGTSSLPSL 178 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG G GG G G A GG G Sbjct: 179 GSFGQNPGGPGGLGNGLSGGANGGV-GTLGGANGAGGFNAVGGANGGPNG 227 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 12 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 53 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 15 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 71 Query: 522 XGGAXXG 502 GGA G Sbjct: 72 AGGAVAG 78 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 186 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 224 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +2 Query: 515 PPXXGXXPPP--XPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA---XPXPXXXP 679 PP PPP PP P P P PP P PP PP + P P Sbjct: 532 PPPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPPPQNSA 591 Query: 680 PXPPPPGPPXXPP 718 PPP G PP Sbjct: 592 GGPPPMGYAGYPP 604 Score = 43.6 bits (98), Expect = 4e-04 Identities = 36/149 (24%), Positives = 37/149 (24%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP G PP P PP P P P P PP P P PP Sbjct: 547 PPVPGQQQPP-PGPPPPGQPPTGGQQQPPPGPPQSQYGPPPPQNSAGGPPPMGYAGYPPN 605 Query: 695 PGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPP 874 PG P P P P P P Sbjct: 606 PGQYGQAGAGGGPPPSGYWPPPPPTSSAQSPYQAYQQQQQQQAAAGGGAGAP-PGSSYPG 664 Query: 875 XPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P A PPPP P + PP Sbjct: 665 GP-PTSGAAPPPPPGGAYSTTAPSQTPPP 692 Score = 42.3 bits (95), Expect = 0.001 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPP 730 PP P P PP P P P PP PP G PP PP Sbjct: 533 PPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPP 578 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 513 PXPSXXXXPP----PXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXP 647 P P PP PP PP P P PPP PP PP P Sbjct: 539 PPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPPP 587 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGG GGG G GG GGG Sbjct: 99 GGGGGGGVIGGGGMPGGGMMVTPTSTPRGGANMQGGGGGG 138 Score = 36.3 bits (80), Expect = 0.063 Identities = 37/145 (25%), Positives = 38/145 (26%), Gaps = 11/145 (7%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXP-----PXPPP-AXPXPXXX 676 PP G PPP P PP P P PPP A P P Sbjct: 486 PPTQGYGPPP-PGPPNAAQGG-YHHGPAGAATGASGHGYQPNAGAGQGPPPGAYPPPPGS 543 Query: 677 PPXPPPPGPPXXPPXXPPXXPXP---XXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP 847 PP PG PP PP P P P P Sbjct: 544 QQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPPPQNSAGGPPPMGYAGYP 603 Query: 848 PXPXPXXPPXPAPXPXPA--XPPPP 916 P P P P+ PPPP Sbjct: 604 PNPGQYGQAGAGGGPPPSGYWPPPP 628 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PPP PP P P PP PP P P PP Sbjct: 533 PPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPP 578 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP----XPPPPXXP 665 P PPP PPP PP PPP PP PPP P Sbjct: 524 PNAGAGQGPPPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPP 578 Score = 31.9 bits (69), Expect = 1.4 Identities = 36/150 (24%), Positives = 36/150 (24%), Gaps = 12/150 (8%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXP------PXPPPAXPXPXXXPPXPPPPGPPX 709 P P P P PP P P PP P P P GPP Sbjct: 430 PGGPGPQPGAGGPGVPPPQSPYRVSYQQQQQQHSHYPGYPPQ-PQTQYQPQGAYPYGPPT 488 Query: 710 X----PPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXX-PP 874 PP PP P PP P PP Sbjct: 489 QGYGPPPPGPPNAAQGGYHHGPAGAATGASGHGYQPNAGAGQGPPPGAYPPPPGSQQVPP 548 Query: 875 XPAPX-PXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PPP P P PP Sbjct: 549 VPGQQQPPPGPPPPGQPPTGGQQQPPPGPP 578 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 537 PPPXPPXPP--PXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PPP PP P P P PPPP P PP P Sbjct: 826 PPPNGATPPMPPNQYQPAPGAPQGPYGGPPPPQAYGPPPPGSAYP 870 Score = 31.1 bits (67), Expect = 2.4 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 8/81 (9%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP------PPAXP 661 PP P G P PP P P PP P PP PP Sbjct: 836 PPNQYQPAPGAPQGPYGGPPPPQAYGP----PPPGSAYPGHAYHQPPQAGGYAQYPPTQG 891 Query: 662 XPXXXPPXP--PPPGPPXXPP 718 P PPPG P PP Sbjct: 892 YQGYRPAGAQMPPPGAPQGPP 912 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGGG GG G G G G G G GG G Sbjct: 694 GGGGAGGGNNNPNGPNAQQSTPPPQGGAGGGAGPSGPGGAGQQYAG 739 Score = 30.3 bits (65), Expect = 4.1 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGG 535 G GPGGGG GG G G G G G G G GG GGG Sbjct: 55 GSGVGPGGGG-GGIPGGGGILS---MGMQQQQQRPPMGVPGSPGSIISGGGGGGGVIGGG 110 Query: 534 XXPXXG 517 P G Sbjct: 111 GMPGGG 116 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P PPP PP P P Sbjct: 833 PPMPPNQYQPAPGAPQGPYGGPPPPQAYGPPPPGSAYP 870 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 45.2 bits (102), Expect = 1e-04 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPA---PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 PP PP G PP PA PP P P PP P P PP PPP P Sbjct: 275 PPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPG-MPAP------PPRPPPTNWRP- 326 Query: 671 XXPPXPPPPGPPXXP 715 PP P PP P P Sbjct: 327 --PPVPFPPTPYARP 339 Score = 44.8 bits (101), Expect = 2e-04 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPX------PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP---XP 688 PPP APP P PP P P P PP PP PP P Sbjct: 237 PPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIP 296 Query: 689 PPPGPPXXPPXXPPXXPXPXXXPXP 763 PPP PP P P P P Sbjct: 297 PPPRMMQPNAWAPPGMPAPPPRPPP 321 Score = 44.0 bits (99), Expect = 3e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 4/92 (4%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA---XPXPX 670 PP P P PP P P P P P P P PP PP A P P Sbjct: 244 PPPVVPVSNNNMGMLAPPPPVPQPA-PFPATIPPP-PLPPMTGGQPPLPP-AMGIPPPPR 300 Query: 671 XXPPXP-PPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPG P PP PP P P P Sbjct: 301 MMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFP 332 Score = 44.0 bits (99), Expect = 3e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP P P P P PP P PPP P P P PP P Sbjct: 261 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPP 320 Query: 716 P--XXPPXXPXPXXXPXPXA 769 P PP P P P P A Sbjct: 321 PTNWRPPPVPFP---PTPYA 337 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP P PP P PP P P P P P PP P P P Sbjct: 262 PPVPQPAPFPATIPPPPLPPMTGGQPPLP--PAMGIPPPPRMMQPNAWAPPGMPAP---P 316 Query: 680 PXPPPPGPPXXPPXXPP 730 P PPP P PP Sbjct: 317 PRPPPTNWRPPPVPFPP 333 Score = 38.3 bits (85), Expect = 0.016 Identities = 33/123 (26%), Positives = 33/123 (26%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAX 772 P P P PP P P P G PP P P P P P Sbjct: 221 PQMPGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 280 Query: 773 XXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 PP P P AP PA PP P P PP P Sbjct: 281 PMTGGQPPLPPAMGI---------PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRP-PPVP 330 Query: 953 XPP 961 PP Sbjct: 331 FPP 333 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPX-PP 691 P G P P P P PP P PPP P P P PP Sbjct: 221 PQMPGQIPAQMPGQMMP----PPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPP 276 Query: 692 PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXP 871 PP PP PP P P P PP P P P Sbjct: 277 PPLPP-MTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP P PP P + PPP P P P PPP P Sbjct: 232 PGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLP 280 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXP-------XPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXX 636 P PP P P PPPPR P P P PP P P Sbjct: 269 PFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPP 328 Query: 637 PPSPPRP 657 P PP P Sbjct: 329 VPFPPTP 335 Score = 32.3 bits (70), Expect = 1.0 Identities = 26/115 (22%), Positives = 27/115 (23%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P P + P P PP P P P PP P Sbjct: 224 PGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMT 283 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPP 876 P P P PPP PP PPP P P P Sbjct: 284 GGQPPLP---PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP-PPXXXXXXXXXXXXXXPXPPXPXPP 945 PPPP P P P PP P PP P PP P Sbjct: 260 PPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQP 304 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPPPPPXPXXPP-PPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPP 945 PP PP PP PP PPP P PP PP Sbjct: 277 PPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAPPPRPPP 321 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPP----XXXPPXPPPP 656 PPP PP P P P PP PPPP PP PPPP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PPP P P P P PPP PPP PPPP P Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPX 733 PP P P P P P P P P PPP P PPPP PP P Sbjct: 271 PPPP----PPPMAPAAPPPPPPPINGAAPPPPP--PPMINGGALPPPPPPPSMQMASRPR 324 Query: 734 XPXP 745 P P Sbjct: 325 TPDP 328 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 PP P PP P PP P P P PP PPP PP PPP P Sbjct: 271 PPPPPPPMA------PAAPPPPPP-PINGAAPPPPPPPMINGGALPPPPPPPSMQMASRP 323 Query: 719 XXP 727 P Sbjct: 324 RTP 326 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXP----PXPPXPXPXXXXXXXPPSPPRP 657 P PPPP P P P P P P PP P P PP PP P Sbjct: 271 PPPPPP-PMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP---GPPXX 712 P P P PP P P PP PPP P PP PPPP G Sbjct: 255 PTRKPSQPVGVSAKTTPPP---PPPPMAPAAPPPPPP--PINGAAPPPPPPPMINGGALP 309 Query: 713 PPXXPP 730 PP PP Sbjct: 310 PPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP----XPPPXXXXXXXXXXXXXXPXPP 930 PPPPP P PPPP PP PPP P PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 38.3 bits (85), Expect = 0.016 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPP---XPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P + PPP PP PP P P PPP PPP P P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTP 326 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX-----PPPPXXXXXPPXPPRPXPP 961 PP P P P P P P P PPPP PP P PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 37.5 bits (83), Expect = 0.027 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PA PPPP PP P PP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P PP PPPP PP PP P P Sbjct: 271 PPPPPP--PMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPP 311 Score = 36.7 bits (81), Expect = 0.048 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPP P PP PPP PP PP P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPP--PXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPP P P P PP PP PP P PP+ Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPS 316 Score = 36.3 bits (80), Expect = 0.063 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P PP P P PPPP PP PP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PA P P PP P P PP PPP P P P Sbjct: 276 PPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP P P PP P P PP P P PP PPP+ Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAP--PPPPPPMINGGALPPPPPPPS 316 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P P PPP P P PP PPP Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP-----PXPPXPXPXXXXXXXPPSPPRP 657 PP P PPPP P P P P P PP P P P P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPP 598 PP PP G PPP P P P P PP Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 558 PPPXPXAPXXXXXPXPPPAPPPP--XXXPPXPPPP 656 P P P PP PPPP PP PPPP Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 PPP P P P P P P P PPP P P P Sbjct: 275 PPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P+ P PPPP PP P PP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPP 288 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP PPP P PP PP P P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P + P PPPP PP PP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP-----XPPPPXXP 665 P P P A P PP AP P PP PPPP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP P PP P PP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 45.2 bits (102), Expect = 1e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 7/87 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP-----APPXPXXXXPXPXXPPXPXPX--PXXXXXXPPXPPPAX 658 PP P PPP P APP P P P P P P P PP Sbjct: 158 PPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGG 217 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P PPP G P PP P Sbjct: 218 VMVMPSPTPPPPAGGVLVMPRPPPPPP 244 Score = 42.7 bits (96), Expect = 7e-04 Identities = 28/108 (25%), Positives = 28/108 (25%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXX 814 PP PP P P PPP P PP P P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPF-PDRPPAYTPTPDPMP 213 Query: 815 XXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P P P P P PP PP PP P Sbjct: 214 PVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTP 261 Score = 42.3 bits (95), Expect = 0.001 Identities = 31/115 (26%), Positives = 32/115 (27%), Gaps = 1/115 (0%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXX 711 P PPPP P P PP PP +PP P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPP-----------AMAPPLPAKPYPYPDLAAMPFPDRP 202 Query: 712 XXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXP-PPPPPXPXXPPPPXPPXPP 873 P P P PP P PPPPP P PP PP Sbjct: 203 PAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 41.9 bits (94), Expect = 0.001 Identities = 30/98 (30%), Positives = 31/98 (31%), Gaps = 10/98 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPX----PXPXPXXXXXX----PPXPPPA 655 PP +PP P P P P P PP P P P P PPPA Sbjct: 171 PPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPA 230 Query: 656 XPX--PXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP G P PP P P Sbjct: 231 GGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPAEVAPPP 268 Score = 38.3 bits (85), Expect = 0.016 Identities = 32/126 (25%), Positives = 32/126 (25%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P PP PPA P P P P P PP P P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAY-TPTPDPMP 213 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P PP PA PPPP P Sbjct: 214 PVGGVMVMPSPTPPPPAGGVLV-------MPRPPPPPPPAGGVLVMPPPPPSFTPAEVAP 266 Query: 944 PRPXPP 961 P P Sbjct: 267 PPSFVP 272 Score = 36.7 bits (81), Expect = 0.048 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 13/90 (14%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXP--XPXXPPXPXPXPXXXXXXPPXPPPA-XPXPXXXP-- 679 PP P P P P P P P P P P P PPA P P P Sbjct: 156 PPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPV 215 Query: 680 --------PXPPPPGPPXXPPXXPPXXPXP 745 P PPPP PP P P Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPP 245 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPP---PPXXXPPXPPP 653 PP PPP P PPP+PP PP P P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 Score = 35.1 bits (77), Expect = 0.15 Identities = 33/133 (24%), Positives = 34/133 (25%), Gaps = 4/133 (3%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P PP P PPP PP P P PP P P P + P P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPP----PPSP-PAMAPPLPAKPYPYPDL----AAMPFP 199 Query: 658 XXPXXXXXXXXXXXXXXXXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPP--- 828 P P P P PP PPPP Sbjct: 200 DRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSF 259 Query: 829 -PXPXXPPPPXPP 864 P PPP P Sbjct: 260 TPAEVAPPPSFVP 272 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 558 PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PPP P PPP P PP PP P P Sbjct: 155 PPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKP 187 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 P P P PP PP P PP PPPA P PPP P Sbjct: 207 PTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGV--LVMPPPPPSFTPAEV 264 Query: 716 PXXPPXXP 739 P P Sbjct: 265 APPPSFVP 272 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 PP P P P P P PPP PP P +P P Sbjct: 154 PPPPPPLEEPEKCPLSPP--PPPSPPAMAPPLPAKPYP 189 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 45.2 bits (102), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPP----XXXPPXPPPP 656 PPP PP P P P PP PPPP PP PPPP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 PPP P P P P PPP PPP PPPP P Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +2 Query: 554 PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPX 733 PP P P P P P P P P PPP P PPPP PP P Sbjct: 271 PPPP----PPPMAPAAPPPPPPPINGAAPPPPP--PPMINGGALPPPPPPPSMQMASRPR 324 Query: 734 XPXP 745 P P Sbjct: 325 TPDP 328 Score = 40.3 bits (90), Expect = 0.004 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 PP P PP P PP P P P PP PPP PP PPP P Sbjct: 271 PPPPPPPMA------PAAPPPPPP-PINGAAPPPPPPPMINGGALPPPPPPPSMQMASRP 323 Query: 719 XXP 727 P Sbjct: 324 RTP 326 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXP----PXPPXPXPXXXXXXXPPSPPRP 657 P PPPP P P P P P P PP P P PP PP P Sbjct: 271 PPPPPP-PMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP---GPPXX 712 P P P PP P P PP PPP P PP PPPP G Sbjct: 255 PTRKPSQPVGVSAKTTPPP---PPPPMAPAAPPPPPP--PINGAAPPPPPPPMINGGALP 309 Query: 713 PPXXPP 730 PP PP Sbjct: 310 PPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPP----XPPPXXXXXXXXXXXXXXPXPP 930 PPPPP P PPPP PP PPP P PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 38.3 bits (85), Expect = 0.016 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPP---XPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P + PPP PP PP P P PPP PPP P P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTP 326 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAX-----PPPPXXXXXPPXPPRPXPP 961 PP P P P P P P P PPPP PP P PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 37.5 bits (83), Expect = 0.027 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PA PPPP PP P PP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 PP PPP P PP PPPP PP PP P P Sbjct: 271 PPPPPP--PMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPP 311 Score = 36.7 bits (81), Expect = 0.048 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PPP P PP PPP PP PP P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPP--PXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPPP P P P PP PP PP P PP+ Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPS 316 Score = 36.3 bits (80), Expect = 0.063 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P PP P P PPPP PP PP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PA P P PP P P PP PPP P P P Sbjct: 276 PPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA 655 PP P P PP P P PP P P PP PPP+ Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAP--PPPPPPMINGGALPPPPPPPS 316 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P P PPP P P PP PPP Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXP-----PXPPXPXPXXXXXXXPPSPPRP 657 PP P PPPP P P P P P PP P P P P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPP 598 PP PP G PPP P P P P PP Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 558 PPPXPXAPXXXXXPXPPPAPPPP--XXXPPXPPPP 656 P P P PP PPPP PP PPPP Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 PPP P P P P P P P PPP P P P Sbjct: 275 PPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P+ P PPPP PP P PP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPP 288 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P PP PPP P PP PP P P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P + P PPPP PP PP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPP-----XPPPPXXP 665 P P P A P PP AP P PP PPPP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP P PP P PP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 >BT023264-1|AAY55680.1| 154|Drosophila melanogaster IP02678p protein. Length = 154 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/79 (37%), Positives = 32/79 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG G G G GG G GGG G G G GG G G Sbjct: 27 GLLGGGFGGSVGLSAGNGVGGGLYS-GFGGGGYPGGYASGYPGGYG-GGYSGYN----GY 80 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG+G GGG P G + G Sbjct: 81 GGSGFGGGYYPGGGYSGFG 99 Score = 44.4 bits (100), Expect = 2e-04 Identities = 34/93 (36%), Positives = 35/93 (37%), Gaps = 6/93 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGX-GGXXXGX-GXAGGGXGGXXXXXX-GXGXGX-- 598 G G G G GG G GGGG GG G G GGG G G G G Sbjct: 32 GFGGSVGLSAGNGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYP 91 Query: 597 -GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 GG G G GG GGG GG+ G Sbjct: 92 GGGYSGFGHRPHHHGGYYPGGGSYHNQGGSYGG 124 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G GG G G GG G G GGG G G G G G Sbjct: 38 GLSAGNGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPG 92 Score = 29.9 bits (64), Expect = 5.5 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = -1 Query: 959 AGXGAGGX---GXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG---GGG 813 AG G GG G GG G GGG G G G G GGG GGG Sbjct: 41 AGNGVGGGLYSGFGGGGYPGGYASGYPGGY-GGGYSGYNGYGGSGFGGGYYPGGG 94 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/76 (32%), Positives = 26/76 (34%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP 715 PPP PA P P P PP P P P P P+ P PP PP Sbjct: 699 PPPMPASPTASSAAPPPPPPPAP-PAPPPPPGFSPLGSPSGSLASTAP--SPPHAPPMLS 755 Query: 716 PXXPPXXPXPXXXPXP 763 PP P P P Sbjct: 756 SFQPPPPPVAGFMPAP 771 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP A P PP P PP P P P P P P PP A P Sbjct: 700 PPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP-SGSLASTAPSPPHAPPMLSSFQ 758 Query: 680 PXPPP 694 P PPP Sbjct: 759 PPPPP 763 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +3 Query: 549 PPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PP PPP P +P PPP PP P P PPPP Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAP---PAPPPPP 728 Score = 40.7 bits (91), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPP P PPPP PP P PP P P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP 736 Score = 40.7 bits (91), Expect = 0.003 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 PP PP P P A P PPPAPP P P P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSP 732 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 537 PPPXPPXP--PPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 PPP PP P P A P PPAPPPP P P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP 736 Score = 36.7 bits (81), Expect = 0.048 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 6/32 (18%) Frame = +1 Query: 532 PXPPPPRPXXP------PXPXPXPXPPXPPXP 609 P PPPP P P P P P P PP PP P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPP 727 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 860 PXXPPXPA-PXPXPAXPPPPXXXXXPPXPPRPXPP 961 P PP PA P A PPPP PP PP P PP Sbjct: 697 PPPPPMPASPTASSAAPPPP----PPPAPPAPPPP 727 Score = 35.9 bits (79), Expect = 0.083 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPP 651 PP P PP P P P P P P P P PSPP Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPP 748 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 10/31 (32%) Frame = +1 Query: 814 PPPPPPXPXXP----------PPPXPPXPPP 876 PPPPPP P P PPP PP PPP Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPP 726 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 814 PPPPPPXPXXPPPP 855 PPPPPP P PPPP Sbjct: 714 PPPPPPAPPAPPPP 727 Score = 33.5 bits (73), Expect = 0.44 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPP 876 PPPPP P P PP PP P Sbjct: 713 PPPPPPPAPPAPPPPPGFSP 732 Score = 33.1 bits (72), Expect = 0.59 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P P P P P PPPP PP PP Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPP 728 Score = 32.7 bits (71), Expect = 0.77 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPPPPP P PP PP PP Sbjct: 713 PPPPPP----PAPPAPPPPP 728 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 PP P P P + P P PPPP PP P Sbjct: 698 PPPPMPASPTASSAAPPP--PPPPAPPAPPPPP 728 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP--XPAXPPPPXXXXXPPXPPRPXP 958 PP P P PP P P P P P P PP P Sbjct: 713 PPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPP 752 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGG 560 G G G G GGGG GGG G G+ G Sbjct: 60 GGGGSGSRGLQDPGGGGGGGGGGGGSVSGSVSGSG 94 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 P P P+ PP PPP P PP PPPP P P Sbjct: 697 PPPPPMPASPTASSAAPPPPPP----------PAPPAPPPPPGFSPLGSP 736 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 622 GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGG G G G G GGG GG G G Sbjct: 60 GGGGSGSRGLQDPGGGGGGGGGGGGSVSGSVSGSG 94 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = -1 Query: 875 GGGXGGXG---GGGXXGXGGGGGG 813 GGG G G GG G GGGGGG Sbjct: 61 GGGSGSRGLQDPGGGGGGGGGGGG 84 Score = 29.1 bits (62), Expect = 9.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 844 PPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPP P P P PP P PPAP P Sbjct: 696 PPPPPPMPASP-------TASSAAPPPPPPPAPPAPPP 726 >BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p protein. Length = 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 35/118 (29%), Positives = 35/118 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GG G G G G G GG Sbjct: 59 GGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYG 118 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GGG GG G G GGG G G Sbjct: 119 YD------GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 44.4 bits (100), Expect = 2e-04 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 11/97 (11%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-------XAGGGXGGXXXXXXGXGXGX 598 G G G GG G GG GG G G AGG G G G G Sbjct: 67 GGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGG 126 Query: 597 G----GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG P GG GG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 41.5 bits (93), Expect = 0.002 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGG-GGXGGXXX------GXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G GG GG GG GG GG GG G GGG GG G G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 579 --GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G G G GG G G GGG GG G G GG G G G Sbjct: 109 GGYYNGYDYGYDGYGYGGGFEGNGYGGGG-GGNMGGGRGGPRGGGGPKGGGGFNGGKQRG 167 Query: 549 GXG 541 G G Sbjct: 168 GGG 170 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GGGG G G G G G GG G GG Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G G GG GGG GG G G G GG GGG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGG 536 G GG GG G G GG GG G+ G GGG GG G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAG 101 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGG-GGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G G GG G GG GGG G G GG GG G G G Sbjct: 118 GYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 169 >BT001468-1|AAN71223.1| 391|Drosophila melanogaster GM32356p protein. Length = 391 Score = 44.8 bits (101), Expect = 2e-04 Identities = 40/159 (25%), Positives = 40/159 (25%), Gaps = 12/159 (7%) Frame = +2 Query: 512 APPXXGXXPPPX----PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXX 676 AP PP PAPP P P P P P P P P PA P Sbjct: 192 APAYEAPAPPAPAYEAPAPPAPVYEAPAPAAPAYEAPAPAAPAYEAPAPAAPAYETPATD 251 Query: 677 PPXPPPPGPPXXPP-------XXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXX 835 P PP P PP P P P Sbjct: 252 YSAPAPPAPAYEPPASSYTQGYSQPAQPSYVGAPPAQIVYQPIIYLSTPLASKSSTSQVE 311 Query: 836 XXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P PP P P P P P P PP P Sbjct: 312 YDDQKYVTPTAPPSP-PPPAPVYEAPSQSCYQPAAPPAP 349 >BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p protein. Length = 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 35/118 (29%), Positives = 35/118 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GG G G G G G GG Sbjct: 59 GGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYG 118 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GGG GG G G GGG G G Sbjct: 119 YD------GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 44.4 bits (100), Expect = 2e-04 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 11/97 (11%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-------XAGGGXGGXXXXXXGXGXGX 598 G G G GG G GG GG G G AGG G G G G Sbjct: 67 GGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGG 126 Query: 597 G----GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG P GG GG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 41.5 bits (93), Expect = 0.002 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGG-GGXGGXXX------GXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G GG GG GG GG GG GG G GGG GG G G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 579 --GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G G G GG G G GGG GG G G GG G G G Sbjct: 109 GGYYNGYDYGYDGYGYGGGFEGNGYGGGG-GGNMGGGRGGPRGGGGPKGGGGFNGGKQRG 167 Query: 549 GXG 541 G G Sbjct: 168 GGG 170 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GGGG G G G G G GG G GG Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G G GG GGG GG G G G GG GGG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGG 536 G GG GG G G GG GG G+ G GGG GG G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAG 101 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGG-GGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G G GG G GG GGG G G GG GG G G G Sbjct: 118 GYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 169 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 44.8 bits (101), Expect = 2e-04 Identities = 34/111 (30%), Positives = 34/111 (30%), Gaps = 2/111 (1%) Frame = -3 Query: 960 GGXGRGGXGG--XXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 GG G G G G GG G G G GG G G GG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAP 180 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G G G G GGG GG Sbjct: 181 SPAGPQPDGEDGADGADGPDGPDGS-KGGKGGKGGKGARNGAG-GGGGAGG 229 Score = 44.0 bits (99), Expect = 3e-04 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 2/92 (2%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGG 592 A G G G G GG G G GG G G G GGG GG G G Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGA 179 Query: 591 XXGXGXXXXGXGGA-GXGGGXXPXXGGAXXGG 499 G G GA G G P GG Sbjct: 180 PSPAGPQPDGEDGADGADGPDGPDGSKGGKGG 211 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GG G GG G G+ G GGG GG GGG G G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGG---GSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 AGG G G G G GG GGG G GGGGGG Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 38.3 bits (85), Expect = 0.016 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAGG G G GGG G GGGG G GGGGG Sbjct: 122 GAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGG--GGGGGGG 164 Score = 37.5 bits (83), Expect = 0.027 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG GG G G G AG G G G Sbjct: 145 AGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDG-----EDGADGADGP 199 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 200 DGPDGSKGGKGGKGGKGARNGAGGGGGAGG 229 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 A G GG G GG GG G G G GGGGGG Sbjct: 118 AEAGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGG 162 >AY118297-1|AAM48326.1| 659|Drosophila melanogaster GH07242p protein. Length = 659 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G G GG Sbjct: 582 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG----GFGGG 636 Query: 549 GXGG 538 G GG Sbjct: 637 GGGG 640 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGX---GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG GG G G GGGGG Sbjct: 589 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 640 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 582 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 632 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG--GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GGG AG G G G GG GG GGG Sbjct: 595 GGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 639 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG G GGG GA G GG GG GG Sbjct: 591 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 632 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G G G GGGA G G+ G G G GG G G G Sbjct: 583 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGG 638 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXX 568 G G G G GG G G GG G G G G Sbjct: 568 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 627 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG Sbjct: 628 GGFGGFGGGGGGGANANSNAFGG 650 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---------XGGXGG-GGXXGXGGGGGG 813 AG G GG G G GGG GG GG GG G GGGGGG Sbjct: 581 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 639 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G G G GG G G G GGG G G Sbjct: 606 GANGGGGSAGANAGANGGFGGFGGFGGFGGGG-GGGANANSNAFGGYDGFG 655 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG G GGG GG Sbjct: 598 GGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 640 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 664 GXXGG-GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG GG GG GG G GGG G A G G G G Sbjct: 619 GANGGFGGFGGF--GGFGGGGGGGANANSNAFGGYDGFGFFG 658 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 44.8 bits (101), Expect = 2e-04 Identities = 34/111 (30%), Positives = 34/111 (30%), Gaps = 2/111 (1%) Frame = -3 Query: 960 GGXGRGGXGG--XXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 GG G G G G GG G G G GG G G GG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAP 180 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G G G G GGG GG Sbjct: 181 SPAGPQPDGEDGADGADGPDGPDGS-KGGKGGKGGKGARNGAG-GGGGAGG 229 Score = 44.0 bits (99), Expect = 3e-04 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 2/92 (2%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGG 592 A G G G G GG G G GG G G G GGG GG G G Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGA 179 Query: 591 XXGXGXXXXGXGGA-GXGGGXXPXXGGAXXGG 499 G G GA G G P GG Sbjct: 180 PSPAGPQPDGEDGADGADGPDGPDGSKGGKGG 211 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GG G GG G G+ G GGG GG GGG G G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGG---GSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 AGG G G G G GG GGG G GGGGGG Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 38.3 bits (85), Expect = 0.016 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAGG G G GGG G GGGG G GGGGG Sbjct: 122 GAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGG--GGGGGGG 164 Score = 37.5 bits (83), Expect = 0.027 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG GG G G G AG G G G Sbjct: 145 AGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDG-----EDGADGADGP 199 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 200 DGPDGSKGGKGGKGGKGARNGAGGGGGAGG 229 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 A G GG G GG GG G G G GGGGGG Sbjct: 118 AEAGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGG 162 >AE014298-478|AAN09091.2| 627|Drosophila melanogaster CG3588-PC, isoform C protein. Length = 627 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G G GG Sbjct: 550 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG----GFGGG 604 Query: 549 GXGG 538 G GG Sbjct: 605 GGGG 608 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGX---GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG GG G G GGGGG Sbjct: 557 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 608 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 550 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 600 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG--GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GGG AG G G G GG GG GGG Sbjct: 563 GGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 607 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG G GGG GA G GG GG GG Sbjct: 559 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 600 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G G G GGGA G G+ G G G GG G G G Sbjct: 551 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGG 606 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXX 568 G G G G GG G G GG G G G G Sbjct: 536 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 595 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG Sbjct: 596 GGFGGFGGGGGGGANANSNAFGG 618 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---------XGGXGG-GGXXGXGGGGGG 813 AG G GG G G GGG GG GG GG G GGGGGG Sbjct: 549 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 607 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G G G GG G G G GGG G G Sbjct: 574 GANGGGGSAGANAGANGGFGGFGGFGGFGGGG-GGGANANSNAFGGYDGFG 623 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG G GGG GG Sbjct: 566 GGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 608 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 664 GXXGG-GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG GG GG GG G GGG G A G G G G Sbjct: 587 GANGGFGGFGGF--GGFGGGGGGGANANSNAFGGYDGFGFFG 626 >AE014298-477|AAZ52489.1| 655|Drosophila melanogaster CG3588-PD, isoform D protein. Length = 655 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G G GG Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG----GFGGG 632 Query: 549 GXGG 538 G GG Sbjct: 633 GGGG 636 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGX---GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG GG G G GGGGG Sbjct: 585 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG--GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GGG AG G G G GG GG GGG Sbjct: 591 GGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG G GGG GA G GG GG GG Sbjct: 587 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G G G GGGA G G+ G G G GG G G G Sbjct: 579 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGG 634 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXX 568 G G G G GG G G GG G G G G Sbjct: 564 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 623 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG Sbjct: 624 GGFGGFGGGGGGGANANSNAFGG 646 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---------XGGXGG-GGXXGXGGGGGG 813 AG G GG G G GGG GG GG GG G GGGGGG Sbjct: 577 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G G G GG G G G GGG G G Sbjct: 602 GANGGGGSAGANAGANGGFGGFGGFGGFGGGG-GGGANANSNAFGGYDGFG 651 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG G GGG GG Sbjct: 594 GGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 664 GXXGG-GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG GG GG GG G GGG G A G G G G Sbjct: 615 GANGGFGGFGGF--GGFGGGGGGGANANSNAFGGYDGFGFFG 654 >AE014298-476|AAN09092.1| 655|Drosophila melanogaster CG3588-PA, isoform A protein. Length = 655 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG GG G GG GG A GG GG G G GG G G G GG Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGG-GGSAGANAGANGGFGGFGGFG----GFGGG 632 Query: 549 GXGG 538 G GG Sbjct: 633 GGGG 636 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGX---GXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAG AGG G G G GG GG GG G G GGGGG Sbjct: 585 GAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GG G G G G GA G GG G G G G G Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 664 GXXGGGGXG--GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GGG AG G G G GG GG GGG Sbjct: 591 GGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GG GG G GGG GA G GG GG GG Sbjct: 587 GANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGG 628 Score = 35.9 bits (79), Expect = 0.083 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GG G G G GGGA G G+ G G G GG G G G Sbjct: 579 GGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGG 634 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGGXXGXGXXX 568 G G G G GG G G GG G G G G Sbjct: 564 GNGQSANANSNANAGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGF 623 Query: 567 XGXGGAGXGGGXXPXXGGAXXGG 499 G GG G GGG GG Sbjct: 624 GGFGGFGGGGGGGANANSNAFGG 646 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGG---------XGGXGG-GGXXGXGGGGGG 813 AG G GG G G GGG GG GG GG G GGGGGG Sbjct: 577 AGGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGG 635 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G GGGG G G G GG G G G GGG G G Sbjct: 602 GANGGGGSAGANAGANGGFGGFGGFGGFGGGG-GGGANANSNAFGGYDGFG 651 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG GG G GGG GG Sbjct: 594 GGGADANSGANGGGGSAGANAGANGGFGGFGGFGGFGGGGGGG 636 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 664 GXXGG-GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GG GG GG GG G GGG G A G G G G Sbjct: 615 GANGGFGGFGGF--GGFGGGGGGGANANSNAFGGYDGFGFFG 654 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPP 730 PP PPP P P PP P PPG P P PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPPGVPANPVSLPP 105 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPP P P PP PPPP PP P P P P Sbjct: 73 PPPPPPPPPPPP--PPPPPPPSPPGVPANPVSLPPQPVIVP 111 Score = 44.4 bits (100), Expect = 2e-04 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPPPPP P PPPP PP PP Sbjct: 75 PPPPPPPPPPPPPPPPPSPP 94 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP PP P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSP 93 Score = 44.0 bits (99), Expect = 3e-04 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPPPP P PPPP PP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 43.6 bits (98), Expect = 4e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXP 647 P P PPP PP PPP P P P PP P P PP P Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPPPPP---PPPSPPGVPANPVSLPPQP 107 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 603 PPPAPPPPXXXPPXPPPPXXP 665 PPP PPPP PP PPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSP 93 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 603 PPPAPPPPXXXPPXPPPPXXP 665 PPP PPPP PP PPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 40.7 bits (91), Expect = 0.003 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPA-PPPPXXXPPXPPPP 656 PPP PP PPP P P P P + PP P P P P Sbjct: 77 PPPPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVPLNPADP 117 Score = 40.7 bits (91), Expect = 0.003 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP 873 PPPPPP P PPPP PP P Sbjct: 78 PPPPPPPPPPPPPPSPPGVP 97 Score = 39.9 bits (89), Expect = 0.005 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 650 PAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P PP PPPP PP PP PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 39.9 bits (89), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPP 603 PPPP P PP P P P PP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPP 94 Score = 39.9 bits (89), Expect = 0.005 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 597 PXPPPAPPPPXXXPPXPPPPXXP 665 P PPP PPPP PP P PP P Sbjct: 75 PPPPPPPPPPPPPPPPPSPPGVP 97 Score = 39.5 bits (88), Expect = 0.007 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 514 PXXXXXPXPPPPRPXXPPXPXPXPXPPXPP 603 P P PPPP P PP P P P PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRP 657 P P PP P P P PP PP P P PP+P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 659 PXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P PP PPPP PP PP PP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 647 PPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P A P PP PPPP PP PP P P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLP 104 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPP 650 P P P PPP P P PPP PPPP PP P Sbjct: 62 PRHVGKPKAKLPPPPPPP--------PPPPPPPPPPPPSPPGVP 97 Score = 35.9 bits (79), Expect = 0.083 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXP 943 P P PP P P P P PPPP P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 35.9 bits (79), Expect = 0.083 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P PP P P P P PPPP P P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXP 688 P PP P P P PP PP P PP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P PPPP P P PP Sbjct: 75 PPPPPPPPPPPPPPPPPSPPGVPANPVSLPP 105 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +2 Query: 563 PXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP 727 P P P PP P P P PP PPP+ P P PP P P P Sbjct: 68 PKAKLPPPPPPPPPPPPP------PPPPPPSPPGVPANPVSLPP--QPVIVPLNP 114 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P P PPPP PP PP P PP Sbjct: 68 PKAKLPPPPPPPPPPP----PPPPPPPPSPP 94 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPP-PPXXXXXP-PXPPRP 952 P P PP P P P P PP PP P PP+P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 33.1 bits (72), Expect = 0.59 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 872 PXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP PP PP P PP Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPPPPPPPP 91 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXP-XPXXPPXPXPXPXXXXXXPPXP 646 P PP PPP P PP P P P P P P P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVPLNPADP 117 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 550 RPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPP 651 +P P P P PP PP P P PPSPP Sbjct: 67 KPKAKLPPPPPPPPPPPPPPPP------PPPSPP 94 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 689 PPPGPPXXPPXXPPXXPXPXXXPXP 763 PPP PP PP PP P P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXP 600 P PP P P PPPP P P P PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVP-ANPVSLPPQP 107 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 845 PPXPXP-XXPPXPAPXPXPAXPP--PPXXXXXPPXPPRP 952 PP P P PP P+P PA P PP P P P Sbjct: 79 PPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVPLNPADP 117 >AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA protein. Length = 263 Score = 44.8 bits (101), Expect = 2e-04 Identities = 34/111 (30%), Positives = 34/111 (30%), Gaps = 2/111 (1%) Frame = -3 Query: 960 GGXGRGGXGG--XXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXX 787 GG G G G G GG G G G GG G G GG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAP 180 Query: 786 XXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G G G G GGG GG Sbjct: 181 SPAGPQPDGEDGADGADGPDGPDGS-KGGKGGKGGKGARNGAG-GGGGAGG 229 Score = 44.0 bits (99), Expect = 3e-04 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 2/92 (2%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG-XGG 592 A G G G G GG G G GG G G G GGG GG G G Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGA 179 Query: 591 XXGXGXXXXGXGGA-GXGGGXXPXXGGAXXGG 499 G G GA G G P GG Sbjct: 180 PSPAGPQPDGEDGADGADGPDGPDGSKGGKGG 211 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G G GG G GG G G+ G GGG GG GGG G G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGG---GSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 AGG G G G G GG GGG G GGGGGG Sbjct: 120 AGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 38.3 bits (85), Expect = 0.016 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAGG G G GGG G GGGG G GGGGG Sbjct: 122 GAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGG--GGGGGGG 164 Score = 37.5 bits (83), Expect = 0.027 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGX 589 A G G G G GG GG G G G AG G G G Sbjct: 145 AGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDG-----EDGADGADGP 199 Query: 588 XGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 200 DGPDGSKGGKGGKGGKGARNGAGGGGGAGG 229 Score = 37.1 bits (82), Expect = 0.036 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 947 AGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 A G GG G GG GG G G G GGGGGG Sbjct: 118 AEAGGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGG 162 >AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-PD, isoform D protein. Length = 178 Score = 44.8 bits (101), Expect = 2e-04 Identities = 35/118 (29%), Positives = 35/118 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GG G G G G G GG Sbjct: 59 GGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYG 118 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GGG GG G G GGG G G Sbjct: 119 YD------GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 44.4 bits (100), Expect = 2e-04 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 11/97 (11%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-------XAGGGXGGXXXXXXGXGXGX 598 G G G GG G GG GG G G AGG G G G G Sbjct: 67 GGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGG 126 Query: 597 G----GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG P GG GG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 41.5 bits (93), Expect = 0.002 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGG-GGXGGXXX------GXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G GG GG GG GG GG GG G GGG GG G G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 115 Query: 579 --GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 116 DYGYDGYGYGGGFEGNGYGGGGGGNMGGG 144 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G G G GG G G GGG GG G G GG G G G Sbjct: 109 GGYYNGYDYGYDGYGYGGGFEGNGYGGGG-GGNMGGGRGGPRGGGGPKGGGGFNGGKQRG 167 Query: 549 GXG 541 G G Sbjct: 168 GGG 170 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GGGG G G G G G GG G GG Sbjct: 121 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 163 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G G GG GGG GG G G G GG GGG Sbjct: 127 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 170 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGG 536 G GG GG G G GG GG G+ G GGG GG G G Sbjct: 56 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAG 101 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGG-GGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G G GG G GG GGG G G GG GG G G G Sbjct: 118 GYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 169 >AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-PB, isoform B protein. Length = 344 Score = 44.8 bits (101), Expect = 2e-04 Identities = 35/118 (29%), Positives = 35/118 (29%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG G GG G G G G G GG Sbjct: 225 GGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYG 284 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 G G G G GG GG GGG GG G G GGG G G Sbjct: 285 YD------GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 336 Score = 44.4 bits (100), Expect = 2e-04 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 11/97 (11%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXG-------XAGGGXGGXXXXXXGXGXGX 598 G G G GG G GG GG G G AGG G G G G Sbjct: 233 GGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGG 292 Query: 597 G----GXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G G G G G GG P GG GG Sbjct: 293 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 329 Score = 41.5 bits (93), Expect = 0.002 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGG-GGXGGXXX------GXGXAGGGXGGXXXXXXGXGXGXGGXXGX 580 G GG GG GG GG GG GG G GGG GG G G G Sbjct: 222 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGY 281 Query: 579 --GXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G GG GG Sbjct: 282 DYGYDGYGYGGGFEGNGYGGGGGGNMGGG 310 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGA 550 GG G G G G GG G G GGG GG G G GG G G G Sbjct: 275 GGYYNGYDYGYDGYGYGGGFEGNGYGGGG-GGNMGGGRGGPRGGGGPKGGGGFNGGKQRG 333 Query: 549 GXG 541 G G Sbjct: 334 GGG 336 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG-GXGXXXXXGAXGXGGGXGGXGG 539 G GGG G GGGG G G G G G GG G GG Sbjct: 287 GYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGG 329 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 664 GXXGGG-GXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G G G GG GGG GG G G G GG GGG Sbjct: 293 GFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 336 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 664 GXXGG--GGXGGXXXGGGGAGGGXGXXXXXGAXGX-GGGXGGXGGG 536 G GG GG G G GG GG G+ G GGG GG G G Sbjct: 222 GMRGGPRGGMRGGRGGYGGRGGYNNQWDGQGSYGGYGGGYGGYGAG 267 Score = 33.1 bits (72), Expect = 0.59 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -2 Query: 664 GXXGGGGXGGXXXGG-GGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 G G G GG G GG GGG G G GG GG G G G Sbjct: 284 GYDGYGYGGGFEGNGYGGGGGGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGG 335 >AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-PA protein. Length = 1701 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP-PPGPP 706 P P PP P P P P P P P P PP PP PP PP Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPP 1665 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PP P P P P P P PP P PP PP P P Sbjct: 1624 PDLPPLPLPLPWPPLPLPE-IPLPLPPLPTALPPLPPLPPLP 1664 Score = 37.1 bits (82), Expect = 0.036 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 547 PRPXXPPXPXPXPXPPXP----PXPXPXXXXXXXPPSPPRPXXP 666 P P PP P P P PP P P P P PP PP P P Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLP-PLPTALPPLPPLPPLP 1664 Score = 36.3 bits (80), Expect = 0.063 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P P P P P P P P P A PP PP PP P Sbjct: 1618 PSILPLPDLPPLPLPLPWPPLPLPEIPLPL--PPLPTALPPLPPLPPLPPLP 1667 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 845 PPXPXPXX-PPXPAPX-PXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P PP P P P P P P PP PP P P Sbjct: 1627 PPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPPLP 1667 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPR--PXPP 961 P P PP P P P P P P PP P P PP Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPP 1659 Score = 34.3 bits (75), Expect = 0.25 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = +2 Query: 518 PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXPPXPPP 694 P P P P PP P P P PP P P PP PP P P P Sbjct: 1624 PDLPPLPLPLPWPPLPLPEIPLP-LPPLPTALP----PLPPLPPLPPLPEVNLTAISLPE 1678 Query: 695 PGPPXXPPXXPPXXPXP 745 P PP P P Sbjct: 1679 ISLPNLPPLPQLPNPFP 1695 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPP-PXXXXXXXXXXXXXXP-XPPXPXPPAPXP 957 P PP P P PP PP PP P P PP P P P P Sbjct: 1646 PLPPLPTALPPLPPLPPLPPLPEVNLTAISLPEISLPNLPPLPQLPNPFP 1695 Score = 32.7 bits (71), Expect = 0.77 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +2 Query: 638 PXPP-PAXPXPXXXPPXPPPPGP---PXXPPXXPPXXPXPXXXPXP 763 P P P P P PP P P P P P PP P P P P Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPPLP 1667 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXP 666 P P P PP P P P P P P P P PP PP P P Sbjct: 1613 PADLGPSILPLPDLPPLPLPLPWPPLPLPEIPLPLPPLP-TALPPLPPLPPLPPLP 1667 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPX-PXXXXXXPPXPPPAXPXPXXXPPXP 688 P P P P P P PP P P P P PP P P PP P Sbjct: 1618 PSILPLPDLPPLPLPLPW-PPLPLPEIPLPLPPLPTALPPLPPLP-PLPPLP 1667 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +1 Query: 820 PPPPXPXXPPP-PXPPXPPPXXXXXXXXXXXXXXPXPP-XPXPPAP 951 P P P P P P PP P P P PP P PP P Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPPLP 1667 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 A P P PAP P P P P P P P P PPP P P P PP Sbjct: 153 AAPAKAAAPAAAPAPAAPKAA-PAPAAAPKPAPPPPAAGA--PKPPP--PPPPKAAPRPP 207 Query: 692 PPGP 703 PP P Sbjct: 208 PPAP 211 Score = 43.2 bits (97), Expect = 5e-04 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPX---PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPX 748 P P P P P P PA P P P PPPP PP P PP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAA 214 Query: 749 XXP 757 P Sbjct: 215 LKP 217 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P+ P P P P P PPP PP PP P P Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 38.3 bits (85), Expect = 0.016 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PA P PA PPP PP PP P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPP 200 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 638 PXPPPAXPXPXXXP-PXPPPP--GPPXXPPXXPPXXPXPXXXPXPXA 769 P P A P P P P PPPP G P PP PP P P A Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVA 213 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PAP P A P P P PRP PP Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P P A P PPP PPP P PP P Sbjct: 176 PAAAPKPAPPPPA---AGAPKPPPPPPPKAAPRPPPPAP 211 Score = 35.9 bits (79), Expect = 0.083 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPP--PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P A P P P PAPP P P P PP P P PP P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPR-----PPPPAPVAALKPAV 219 Query: 677 PPXPPPP 697 PP Sbjct: 220 AQVKVPP 226 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P AP P P PPPP PP PP P Sbjct: 180 PKPAPPPPAAGAPKPPP--PPPPKAAPRPP-PPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPP----AP-PPPXXXP---PXPPPP 656 P P + P P P P AP P PPP AP PPP P P PPPP Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAP-APAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 P PPPP P PP PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPP 200 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP----XXPPXXPXPXXXPXP 763 P P P PA P P P P PP PP PP P P P P Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAPAPAAAPKPAPP--PPAAGAPKPPPPPPPKAAPRP 206 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP PPPP PP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAP 204 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P P PP P P PP PPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPPP 200 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP 861 PPPPP PPPP P Sbjct: 196 PPPPPKAAPRPPPPAP 211 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P PPPP PPP P PPP Sbjct: 192 PKPPPP----PPPKAAPRPPP 208 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 A P P PAP P P P P P P P P PPP P P P PP Sbjct: 153 AAPAKAAAPAAAPAPAAPKAA-PAPAAAPKPAPPPPAAGA--PKPPP--PPPPKAAPRPP 207 Query: 692 PPGP 703 PP P Sbjct: 208 PPAP 211 Score = 43.2 bits (97), Expect = 5e-04 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPX---PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPX 748 P P P P P P PA P P P PPPP PP P PP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAA 214 Query: 749 XXP 757 P Sbjct: 215 LKP 217 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P+ P P P P P PPP PP PP P P Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 38.3 bits (85), Expect = 0.016 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PA P PA PPP PP PP P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPP 200 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 638 PXPPPAXPXPXXXP-PXPPPP--GPPXXPPXXPPXXPXPXXXPXPXA 769 P P A P P P P PPPP G P PP PP P P A Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVA 213 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PAP P A P P P PRP PP Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P P A P PPP PPP P PP P Sbjct: 176 PAAAPKPAPPPPA---AGAPKPPPPPPPKAAPRPPPPAP 211 Score = 35.9 bits (79), Expect = 0.083 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPP--PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P A P P P PAPP P P P PP P P PP P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPR-----PPPPAPVAALKPAV 219 Query: 677 PPXPPPP 697 PP Sbjct: 220 AQVKVPP 226 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P AP P P PPPP PP PP P Sbjct: 180 PKPAPPPPAAGAPKPPP--PPPPKAAPRPP-PPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPP----AP-PPPXXXP---PXPPPP 656 P P + P P P P AP P PPP AP PPP P P PPPP Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAP-APAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 P PPPP P PP PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPP 200 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP----XXPPXXPXPXXXPXP 763 P P P PA P P P P PP PP PP P P P P Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAPAPAAAPKPAPP--PPAAGAPKPPPPPPPKAAPRP 206 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP PPPP PP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAP 204 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P P PP P P PP PPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPPP 200 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP 861 PPPPP PPPP P Sbjct: 196 PPPPPKAAPRPPPPAP 211 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P PPPP PPP P PPP Sbjct: 192 PKPPPP----PPPKAAPRPPP 208 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -2 Query: 649 GGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G G GGGG GGG G G G GGG GG G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGG 539 G GGG GG GGGG GGG G GA G GGG GG GG Sbjct: 188 GAVSGGGGGG---GGGGGGGGIG-----GAGGGGGGGGGNGG 221 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGGG Sbjct: 195 GGGGGGGGGGGIGGAGGGGGG 215 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G GG GG GGGG GG G G GGG GG Sbjct: 188 GAVSGGGGGGGGGGGGGGIGG-AGGGGGGGGGNGG 221 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GG GGG Sbjct: 192 GGGGGGGGGGGGGGIGGAGGG 212 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGGG Sbjct: 194 GGGGGGGGGGGGIGGAGGGGG 214 Score = 37.5 bits (83), Expect = 0.027 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GA G GG G GG G GGG GG GGGG G G GG G Sbjct: 188 GAVSGGGGGGGGGGG--------------GGGIGGAGGGGGGGGGNGGIG 223 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 637 GXXXGGGGAGGGXGXXXXXGAXGXGG-GXGGXGGGXXXXXGXG 512 G GGGG GGG G G G GG G GG GGG G G Sbjct: 188 GAVSGGGGGGGGGG-----GGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 35.9 bits (79), Expect = 0.083 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G GG GG G G GG GG G G G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 35.9 bits (79), Expect = 0.083 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXG 859 G GG GG GGGG G G G G GG G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNG 220 Score = 35.5 bits (78), Expect = 0.11 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G GG GG GGGG G G GAG GG G G GG Sbjct: 192 GGGGGGG-----GGGGGGGIG-GAGGGGGGGGGNGG 221 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G GG G G G GGAG GGG GG G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 GG GGGG GG G GGG GG G G Sbjct: 193 GGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 33.9 bits (74), Expect = 0.34 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 699 PGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 PG GG G G GGG GG G G G GG G G Sbjct: 187 PGAVSGGGGGGGGGGGGGGIGG----AGGGGGGGGGNGGIG 223 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG 822 G G G GG G GG G G G GG GGGG G G G Sbjct: 193 GGGGGGGGGGGGGIG--------------GAGGGGGGGGGNGGIGSG 225 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 714 GXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXG 601 G G GGGG GG G GG GG G G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 696 GGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 GGGG GG G G GG GG G G G Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGA 575 G GGGG G GGGG GGG GA Sbjct: 197 GGGGGGGGGIGGAGGGGGGGGGNGGIGSGA 226 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGA 511 G G G GG G G GG G GGG GA Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIGSGA 226 Score = 29.5 bits (63), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 580 GAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GA GGG GG GGG G G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGG 214 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAG 877 GG G GG GG GGGG G G+G Sbjct: 199 GGGGGGGIGGAGGGGGGGG-GNGGIGSG 225 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +2 Query: 512 APPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP 691 A P P PAP P P P P P P P P PPP P P P PP Sbjct: 153 AAPAKAAAPAAAPAPAAPKAA-PAPAAAPKPAPPPPAAGA--PKPPP--PPPPKAAPRPP 207 Query: 692 PPGP 703 PP P Sbjct: 208 PPAP 211 Score = 43.2 bits (97), Expect = 5e-04 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPX---PPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPX 748 P P P P P P PA P P P PPPP PP P PP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAA 214 Query: 749 XXP 757 P Sbjct: 215 LKP 217 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P+ P P P P P PPP PP PP P P Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 38.3 bits (85), Expect = 0.016 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P PA P PA PPP PP PP P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPP 200 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 638 PXPPPAXPXPXXXP-PXPPPP--GPPXXPPXXPPXXPXPXXXPXPXA 769 P P A P P P P PPPP G P PP PP P P A Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVA 213 Score = 37.9 bits (84), Expect = 0.021 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P P PAP P A P P P PRP PP Sbjct: 174 PAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 540 PPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P P P A P PPP PPP P PP P Sbjct: 176 PAAAPKPAPPPPA---AGAPKPPPPPPPKAAPRPPPPAP 211 Score = 35.9 bits (79), Expect = 0.083 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +2 Query: 503 PXXAPPXXGXXPP--PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P A P P P PAPP P P P PP P P PP P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPR-----PPPPAPVAALKPAV 219 Query: 677 PPXPPPP 697 PP Sbjct: 220 AQVKVPP 226 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P P P AP P P PPPP PP PP P Sbjct: 180 PKPAPPPPAAGAPKPPP--PPPPKAAPRPP-PPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPP----AP-PPPXXXP---PXPPPP 656 P P + P P P P AP P PPP AP PPP P P PPPP Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAP-APAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP 870 P PPPP P PP PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPP 200 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXP 870 PPPPP P P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP----XXPPXXPXPXXXPXP 763 P P P PA P P P P PP PP PP P P P P Sbjct: 151 PGAAPAKAAAPAAAPAPAAPKAAPAPAAAPKPAPP--PPAAGAPKPPPPPPPKAAPRP 206 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 PPPP PPPP PP P Sbjct: 184 PPPPAAGAPKPPPPPPPKAAP 204 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P P PP P P PP PPP Sbjct: 180 PKPAPPPPAAGAPKPPPPPPP 200 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP 861 PPPPP PPPP P Sbjct: 196 PPPPPKAAPRPPPPAP 211 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPP 876 P PPPP PPP P PPP Sbjct: 192 PKPPPP----PPPKAAPRPPP 208 >AE014134-999|AAF52311.2| 381|Drosophila melanogaster CG9050-PA protein. Length = 381 Score = 44.4 bits (100), Expect = 2e-04 Identities = 36/143 (25%), Positives = 36/143 (25%), Gaps = 8/143 (5%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PAXPXPXXXPPXPPPPGPPXXPPXX 724 PAPP P P P P P P P P PA P P PP P PP Sbjct: 198 PAPPAPAYEAPAPPAPAYEAPAPAAPAYEAPAPAAPAYEAPTTDYSAPAPPAPAYEPPAS 257 Query: 725 P-------PXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPA 883 P P P P PP P Sbjct: 258 SYTQGYSQPAQPSYVGAPPAQIVYQPIIYLSTPLASKSSTSQVEYDDQKYVTPTAPPPPP 317 Query: 884 PXPXPAXPPPPXXXXXPPXPPRP 952 P P P P P PP P Sbjct: 318 P-PAPVYEAPSQNCYQPAAPPAP 339 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P PP PPP P P APP P P P Sbjct: 310 PTAPPPPPPPAPVYEAPSQNCYQPAAPPAPNYATPSCQTP 349 >AY058523-1|AAL13752.1| 816|Drosophila melanogaster LD23056p protein. Length = 816 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXXPPXPP 691 PP P APP P P P P P P P PP P P P P PP Sbjct: 197 PPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPP 256 Query: 692 PP 697 P Sbjct: 257 NP 258 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 608 PXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP--PXXPPXXPXP 745 P P P P P P P PP PG P P P P P Sbjct: 211 PVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 P PS PPP P P P P P AP P Sbjct: 218 PAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSP 255 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P+ P P PPP P P P P PP P Sbjct: 211 PVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P +P P PPP P PP P P Sbjct: 210 PPVPAEESPAPSTPASPPPVPSRAAPDPPTPGTP 243 Score = 26.6 bits (56), Expect(2) = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 1/36 (2%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPX-PAXPPPPXXXXXPPXPPRP 952 P P P AP P P P P P PP P Sbjct: 223 PASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 25.4 bits (53), Expect(2) = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP-PXXP 739 PP P P P P PPP P P P P P Sbjct: 210 PPVPAEESPAP--STPASPPPVPSRAAPDPPTPGTP 243 Score = 23.0 bits (47), Expect(2) = 4.9 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPP 916 P P P P P P PP P Sbjct: 235 PDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 10/34 (29%), Positives = 10/34 (29%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P PP P P P PP P Sbjct: 197 PPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVP 230 >AJ238947-1|CAB64936.1| 496|Drosophila melanogaster heterogeneous nuclear ribonucleoprotein(hnRNP) protein. Length = 496 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 214 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 273 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 274 GGGDVDGFGNNPGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 331 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 332 QGTNSLPSLGSFSQNQGG 349 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 217 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 276 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 277 DVDGFGNNPGGAGGFAGNSFGGGAGGPFGGGSFG 310 Score = 37.5 bits (83), Expect = 0.027 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 282 GNNPGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 340 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 341 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 400 Query: 603 G 601 G Sbjct: 401 G 401 Score = 36.3 bits (80), Expect = 0.063 Identities = 38/146 (26%), Positives = 38/146 (26%), Gaps = 1/146 (0%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXX 772 G GG GG G G G GG G G Sbjct: 205 GNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDN 264 Query: 771 GAXGXGXXXGXGXXGGXXGGXXGGPGG-GGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXG 595 G GG G PGG GG G G G AGG GG G G G Sbjct: 265 PFINPWANGG----GGDVDGFGNNPGGAGGFAGNSFG-GGAGGPFGGGSFGNNGFGGGPS 319 Query: 594 GXXGXGXXXXGXGGAGXGGGXXPXXG 517 G G G G P G Sbjct: 320 DFGGNS----GNFGQAQGTNSLPSLG 341 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 210 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 242 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 269 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 270 WANGGGGDVDGFG-NNPGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 326 Score = 34.7 bits (76), Expect = 0.19 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 267 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 268 NPWANGGGGDVDGFGNNPGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 327 Query: 505 XG 500 G Sbjct: 328 FG 329 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 274 GGGDVDGFGNNPGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 317 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 190 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 231 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 193 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 249 Query: 522 XGGAXXG 502 GGA G Sbjct: 250 AGGAVAG 256 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 364 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 402 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 210 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 268 Query: 516 GAXXGG 499 GG Sbjct: 269 PWANGG 274 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 3/111 (2%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G G G G G G G Sbjct: 297 GGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSLPSL 356 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPG--GGGXG-GXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G G A GG G Sbjct: 357 GSFGQNPGGPGGLG--NGLSGGANGGVGTLGGANGAGGFNAVGGANGGPNG 405 >AF275629-1|AAF78762.1| 508|Drosophila melanogaster bancal protein protein. Length = 508 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 214 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 273 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 274 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 331 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 332 QGTNSLPSLGSFSQNQGG 349 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 217 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 276 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 277 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 310 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 282 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 340 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 341 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGALGGANGAGGFNAVGGAN 400 Query: 603 G 601 G Sbjct: 401 G 401 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 210 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 242 Score = 35.9 bits (79), Expect = 0.083 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 269 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 270 WANGGGGDVDGFG-NNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 326 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 267 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 268 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 327 Query: 505 XG 500 G Sbjct: 328 FG 329 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 274 GGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 317 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 190 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 231 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 193 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 249 Query: 522 XGGAXXG 502 GGA G Sbjct: 250 AGGAVAG 256 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 364 GGPGGLGNGLSGGANGGVG--ALGGANGAGGFNAVGGANGG 402 Score = 30.7 bits (66), Expect = 3.1 Identities = 29/110 (26%), Positives = 31/110 (28%), Gaps = 1/110 (0%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXG-GGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXX 784 GG G GG G GGG + G +G G G Sbjct: 298 GGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQ-AQGTNSLPSLGSFSQNQGGTSSLPSL 356 Query: 783 XXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G GG GG G GG G G A GG G Sbjct: 357 GSFGQNPGGPGGLGNGLSGGANGGV-GALGGANGAGGFNAVGGANGGPNG 405 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 210 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 268 Query: 516 GAXXGG 499 GG Sbjct: 269 PWANGG 274 >AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA protein. Length = 242 Score = 44.0 bits (99), Expect = 3e-04 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 12/97 (12%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPA----PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPX 670 P P PPP P PP P P P P P PP P P Sbjct: 84 PVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPS 143 Query: 671 XXPPXPP-----PPGP---PXXPPXXPPXXPXPXXXP 757 PP PP PP P P PP P P P Sbjct: 144 YLPPPPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYLP 180 Score = 43.6 bits (98), Expect = 4e-04 Identities = 37/150 (24%), Positives = 37/150 (24%), Gaps = 2/150 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP PP P P P P P P P P PP P PP Sbjct: 65 PVTVPPPV-YLPPATVKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPP 123 Query: 683 XPP--PPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXP 856 P PP PP P P P PP P Sbjct: 124 KPAYLPPPPPVVKVNPPKPSYLPPPPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYLPPAP 183 Query: 857 XPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 P AP PA P P P Sbjct: 184 VVEQPRYVAPAVVPAFKIPIPSYAAPLEEP 213 Score = 41.5 bits (93), Expect = 0.002 Identities = 43/146 (29%), Positives = 43/146 (29%), Gaps = 10/146 (6%) Frame = +2 Query: 536 PPPXPA--PPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP-----P 694 P P PA PP P P P P P P P P P PP PP P Sbjct: 47 PTPAPAYLPPEPVTVREAPVTVPPPVYLPPATVK-PEIPVVRTPKPAYLPPPPPVIKVNP 105 Query: 695 PGP---PXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPX 865 P P P PP P P P P PP Sbjct: 106 PKPAYLPPPPPVVKVNPPKPAYLPPP-----------PPVVKVNPPKPSYLPPPPPVVKV 154 Query: 866 XPPXPAPXPXPAXPPPPXXXXXPPXP 943 PP PA P PPPP PP P Sbjct: 155 NPPKPAYVP----PPPPAVKVNPPKP 176 Score = 38.7 bits (86), Expect = 0.012 Identities = 34/144 (23%), Positives = 36/144 (25%), Gaps = 4/144 (2%) Frame = +1 Query: 541 PPPRPXXPPXPXPXPXPPXP----PXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXX 708 PP P P P P PP P P PP+ +P P Sbjct: 39 PPSIPFELPTPAPAYLPPEPVTVREAPVTVPPPVYLPPATVKPEIP-----VVRTPKPAY 93 Query: 709 XXXXXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXPPPXXXX 888 P PP PPPPP PP P PPP Sbjct: 94 LPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPPPPPVVK 153 Query: 889 XXXXXXXXXXPXPPXPXPPAPXPA 960 P PP P PA Sbjct: 154 VNPPKPAYVPPPPPAVKVNPPKPA 177 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P PP P PP P P P PPPP PP P Sbjct: 130 PPPPVVKVNPPKPSYLPPPPPV-VKVNPPKPAYVPPPPPAVKVNPPKP 176 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXX 678 P P P PPP PP P P PP P PP P P Sbjct: 84 PVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPS 143 Query: 679 XXXXXXXXXXXXXXXPXPXPGPP 747 P P PP Sbjct: 144 YLPPPPPVVKVNPPKPAYVPPPP 166 >AE014134-2030|AAF53069.1| 816|Drosophila melanogaster CG4713-PA protein. Length = 816 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXP-PPAXPXPXXXPPXPP 691 PP P APP P P P P P P P PP P P P P PP Sbjct: 197 PPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPP 256 Query: 692 PP 697 P Sbjct: 257 NP 258 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 608 PXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXP--PXXPPXXPXP 745 P P P P P P P PP PG P P P P P Sbjct: 211 PVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 P PS PPP P P P P P AP P Sbjct: 218 PAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSP 255 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P+ P P PPP P P P P PP P Sbjct: 211 PVPAEESPAPSTPASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P +P P PPP P PP P P Sbjct: 210 PPVPAEESPAPSTPASPPPVPSRAAPDPPTPGTP 243 Score = 26.6 bits (56), Expect(2) = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 1/36 (2%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPX-PAXPPPPXXXXXPPXPPRP 952 P P P AP P P P P P PP P Sbjct: 223 PASPPPVPSRAAPDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 25.4 bits (53), Expect(2) = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 635 PPXPPPAXPXPXXXPPXPPPPGPPXXPPXXP-PXXP 739 PP P P P P PPP P P P P P Sbjct: 210 PPVPAEESPAP--STPASPPPVPSRAAPDPPTPGTP 243 Score = 23.0 bits (47), Expect(2) = 4.9 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPP 916 P P P P P P PP P Sbjct: 235 PDPPTPGTPVEPTTSVAPTSPPNP 258 Score = 22.6 bits (46), Expect(2) = 2.9 Identities = 10/34 (29%), Positives = 10/34 (29%) Frame = +2 Query: 638 PXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXP 739 P P PP P P P PP P Sbjct: 197 PPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVP 230 >AE013599-3039|AAS64908.1| 315|Drosophila melanogaster CG13425-PD, isoform D protein. Length = 315 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 36 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 95 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 96 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 153 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 154 QGTNSLPSLGSFSQNQGG 171 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 39 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 98 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 99 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 132 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 104 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 162 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 163 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 222 Query: 603 G 601 G Sbjct: 223 G 223 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 32 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 64 Score = 35.9 bits (79), Expect = 0.083 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 32 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 91 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 92 WANGGGGDVDGFG-NNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 148 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 32 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 89 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 90 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 149 Query: 505 XG 500 G Sbjct: 150 FG 151 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 96 GGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 139 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 12 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 53 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 15 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 71 Query: 522 XGGAXXG 502 GGA G Sbjct: 72 AGGAVAG 78 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 186 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 224 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 32 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 90 Query: 516 GAXXGG 499 GG Sbjct: 91 PWANGG 96 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 3/111 (2%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G G G G G G G Sbjct: 119 GGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSLPSL 178 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPG--GGGXG-GXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G G A GG G Sbjct: 179 GSFGQNPGGPGGLG--NGLSGGANGGVGTLGGANGAGGFNAVGGANGGPNG 227 >AE013599-3038|AAM68390.2| 413|Drosophila melanogaster CG13425-PB, isoform B protein. Length = 413 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 131 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 190 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 191 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 248 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 249 QGTNSLPSLGSFSQNQGG 266 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 134 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 193 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 194 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 227 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 199 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 257 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 258 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 317 Query: 603 G 601 G Sbjct: 318 G 318 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 127 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 159 Score = 35.9 bits (79), Expect = 0.083 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 127 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 186 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 187 WANGGGGDVDGFG-NNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 243 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 127 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 184 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 185 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 244 Query: 505 XG 500 G Sbjct: 245 FG 246 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 191 GGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 234 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 107 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 148 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 110 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 166 Query: 522 XGGAXXG 502 GGA G Sbjct: 167 AGGAVAG 173 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 281 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 319 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 127 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 185 Query: 516 GAXXGG 499 GG Sbjct: 186 PWANGG 191 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 3/111 (2%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G G G G G G G Sbjct: 214 GGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSLPSL 273 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPG--GGGXG-GXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G G A GG G Sbjct: 274 GSFGQNPGGPGGLG--NGLSGGANGGVGTLGGANGAGGFNAVGGANGGPNG 322 >AE013599-3036|AAF57450.2| 496|Drosophila melanogaster CG13425-PA, isoform A protein. Length = 496 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 214 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 273 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 274 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 331 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 332 QGTNSLPSLGSFSQNQGG 349 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 217 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 276 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 277 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 310 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 282 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 340 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 341 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 400 Query: 603 G 601 G Sbjct: 401 G 401 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 210 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 242 Score = 35.9 bits (79), Expect = 0.083 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 269 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 270 WANGGGGDVDGFG-NNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 326 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 210 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 267 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 268 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 327 Query: 505 XG 500 G Sbjct: 328 FG 329 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 274 GGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 317 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 190 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 231 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 193 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 249 Query: 522 XGGAXXG 502 GGA G Sbjct: 250 AGGAVAG 256 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 364 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 402 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 210 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 268 Query: 516 GAXXGG 499 GG Sbjct: 269 PWANGG 274 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 3/111 (2%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G G G G G G G Sbjct: 297 GGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSLPSL 356 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPG--GGGXG-GXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G G A GG G Sbjct: 357 GSFGQNPGGPGGLG--NGLSGGANGGVGTLGGANGAGGFNAVGGANGGPNG 405 >AE013599-3035|AAM68389.2| 502|Drosophila melanogaster CG13425-PC, isoform C protein. Length = 502 Score = 44.0 bits (99), Expect = 3e-04 Identities = 35/138 (25%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXX 781 GG G GG GG G G G G GG Sbjct: 220 GGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANG 279 Query: 780 XXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG--GXXXXXXGXG 607 G G G GG G GG GG GG G GGG G G Sbjct: 280 GGGDVDGFGNNAGGA--GGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQA 337 Query: 606 XGXGGXXGXGXXXXGXGG 553 G G GG Sbjct: 338 QGTNSLPSLGSFSQNQGG 355 Score = 39.1 bits (87), Expect = 0.009 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 5/94 (5%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXG--XGXGXG 595 A G G G G G GG GG G G AG G G G G Sbjct: 223 AGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGGGG 282 Query: 594 GXXGXGXXXXGXGG-AG--XGGGXXPXXGGAXXG 502 G G G GG AG GGG GG G Sbjct: 283 DVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFG 316 Score = 37.9 bits (84), Expect = 0.021 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G GG GG GGG AG G G G G G G Sbjct: 288 GNNAGGAGGFAGNSFGGG-AGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSL 346 Query: 777 XXGAXGXGXXXGXGXXG--GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGX 604 + G G G G GG G G GG G G GG G G Sbjct: 347 GSFSQNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFNAVGGAN 406 Query: 603 G 601 G Sbjct: 407 G 407 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGG 548 GGG GG GG AGG G GA G GG GG Sbjct: 216 GGGAGGV--AGGAAGGNGGGFNAGGARGNAGGRGG 248 Score = 35.9 bits (79), Expect = 0.083 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGG--GGGXXXXXXXXXXXXXXXXXXXGXXGGPGXGXGXXXXXXX 702 GGG GG GG G GGG GG G G G G Sbjct: 216 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFINP 275 Query: 701 XXXXXXXXXXGXGXXGRGGXGGXXXXXXXGXGXGGXGGXGXG-XGXGGXXGRGGGGXG 531 G G GG GG G G GG G G GG GG G Sbjct: 276 WANGGGGDVDGFG-NNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSG 332 Score = 35.5 bits (78), Expect = 0.11 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 5/122 (4%) Frame = -2 Query: 850 GGGXGGXGGGXXXXXXXXXXXXXXXXXGXGXGGXXGXRXXGXXXXXXXXXXXXXXXXXXX 671 GGG GG GG G GG R G Sbjct: 216 GGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGG--ADRFGGAAGGAVAGAGMGQRDNPFI 273 Query: 670 XXGXXGGGGX-GGXXXGGGGAGGGXGXXXXXGAXGXGG----GXGGXGGGXXXXXGXGXX 506 GGGG G GGAGG G GA G G G G GGG G Sbjct: 274 NPWANGGGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGN 333 Query: 505 XG 500 G Sbjct: 334 FG 335 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 944 GGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 GG G G GGG GG GGG G G GGG Sbjct: 280 GGGDVDGFGNNAGGAGGFAGNSFGGGAGGPFGGGSFGNNGFGGG 323 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG G G G G GGG GG GG G G G Sbjct: 196 GGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAG 237 Score = 31.5 bits (68), Expect = 1.8 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPX 523 G G G G GGG GG G G GG G GG G Sbjct: 199 GTGSGSTRPSQRGNNRNGGGAGG---VAGGAAGGNGGGFNAGGARGNAGGRGGADRFGGA 255 Query: 522 XGGAXXG 502 GGA G Sbjct: 256 AGGAVAG 262 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 649 GGXGGXXXG-GGGAGGGXGXXXXXGAXGXGG--GXGGXGGG 536 GG GG G GGA GG G GA G GG GG GG Sbjct: 370 GGPGGLGNGLSGGANGGVG--TLGGANGAGGFNAVGGANGG 408 Score = 30.3 bits (65), Expect = 4.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXG-XGGAGXGGGXXPXXG 517 GGG GG G G G G G G GG G G GAG G P Sbjct: 216 GGGAGGVAGGAA-GGNGGGFNAGGARGNAGGRGGADRFGGAAGGAVAGAGMGQRDNPFIN 274 Query: 516 GAXXGG 499 GG Sbjct: 275 PWANGG 280 Score = 29.9 bits (64), Expect = 5.5 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 3/111 (2%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGGXXXXXXXXXXXXXXXXXXXXXX 778 G G GG G G G G G G G Sbjct: 303 GGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSLPSL 362 Query: 777 XXGAXGXGXXXGXGXXGGXXGGXXGGPG--GGGXG-GXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G G A GG G Sbjct: 363 GSFGQNPGGPGGLG--NGLSGGANGGVGTLGGANGAGGFNAVGGANGGPNG 411 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +2 Query: 500 PPXXAPPXX--GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP PP PPP P P P P P P P P P Sbjct: 63 PPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTY 122 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPPP P P P Sbjct: 123 LPPPPPPPRTTTTTTTTTTTTPAPTPVP 150 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 7/73 (9%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP-------PPGPP 706 P PP P P P P P P P P P P PP PP P P Sbjct: 59 PPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPT-PAPTYLPPPPPTTTTTTTTPAPT 117 Query: 707 XXPPXXPPXXPXP 745 P PP P P Sbjct: 118 PAPTYLPPPPPPP 130 Score = 40.7 bits (91), Expect = 0.003 Identities = 30/124 (24%), Positives = 31/124 (25%), Gaps = 2/124 (1%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPP--XPPPPGPPXXPPXXPPXXPXPXXXPXPX 766 P P PP PPP P P PPPP P P P P P Sbjct: 45 PKPEIPFVITSTTEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPP- 103 Query: 767 AXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP P P P P PP PP Sbjct: 104 -----PPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPP 158 Query: 947 RPXP 958 +P P Sbjct: 159 QPEP 162 Score = 37.5 bits (83), Expect = 0.027 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P PP P P PPP P P P P PP Sbjct: 45 PKPEIPFVITSTTEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTP-APTPAPTYLPP- 102 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP-PXPXPXXPPXPAPXPXP 898 PP P P P P P P P P P P P Sbjct: 103 PPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQPEP 162 Score = 36.7 bits (81), Expect = 0.048 Identities = 28/111 (25%), Positives = 28/111 (25%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 PPPP P P P P P PP P P P P Sbjct: 59 PPPPPPTYLP-PKPVPTYLPPPPPTTTTTTTTTPAPTPAP------TYLPPPPPTTTTTT 111 Query: 718 XXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P P P P P PPPP P P Sbjct: 112 TTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQPEP 162 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PP P P PP P P P P P Sbjct: 59 PPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPP 105 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPP-PXXXPPXPPPP 656 P+ P PP PPP PAP P P PP PP P Sbjct: 114 PAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 160 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P P P PP P P P P PP PPR Sbjct: 73 PTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPPR 131 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PAP P P PP P P P P PP PP Sbjct: 103 PPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPV---PTYLPPPPPQ 159 Query: 695 PGP 703 P P Sbjct: 160 PEP 162 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP---PPPXXXPPXPPP 653 P P+ PPP PP P P P P PPP PP P P Sbjct: 116 PTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPP---PPQPEP 162 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P+ P PP PP P P P P PP P P Sbjct: 114 PAPTPAPTYL----PPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 160 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPP P P PPP P P PP P Sbjct: 60 PPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPP 105 >AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p protein. Length = 463 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P P P P P P P PP P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRG--PGPMGPGGPYPQ---MPFPPPVPGMRGPGPMGPM 281 Query: 680 PXPPPPGPP 706 PPPP PP Sbjct: 282 GGPPPPPPP 290 Score = 39.9 bits (89), Expect = 0.005 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 4/99 (4%) Frame = +2 Query: 677 PPXPPPP----GPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP PPP GPP P P P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPP 286 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P PPP P PPR PP Sbjct: 287 PPPPLFMRRNGPGPGPMMGVPPP-MHMMGPRMPPRGIPP 324 Score = 37.5 bits (83), Expect = 0.027 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 1/75 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPX-PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P P P P P P P P P P P GP PP Sbjct: 226 PPPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPP 285 Query: 719 XXPPXXPXPXXXPXP 763 PP P P Sbjct: 286 PPPPPLFMRRNGPGP 300 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 7/83 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP-APPXPXXXXPXPXXP---PXPXPXPXXXXXXPPXPPP---AX 658 P P G P P PP P P P P P P P P P P P Sbjct: 248 PRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVP 307 Query: 659 PXPXXXPPXPPPPGPPXXPPXXP 727 P P PP G P P P Sbjct: 308 PPMHMMGPRMPPRGIPPVGPYGP 330 Score = 33.9 bits (74), Expect = 0.34 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 9/89 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA------XP 661 P P G P P P P P P P P PP PPP P Sbjct: 243 PMGPGPRGPGPMGPGGPYPQMPF----PPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGP 298 Query: 662 XPXXXPPXPPP---PGPPXXPPXXPPXXP 739 P PPP GP P PP P Sbjct: 299 GPGPMMGVPPPMHMMGPRMPPRGIPPVGP 327 >AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FBgn0000810;fs(1)K10 protein. Length = 463 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P P P P P P P PP P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRG--PGPMGPGGPYPQ---MPFPPPVPGMRGPGPMGPM 281 Query: 680 PXPPPPGPP 706 PPPP PP Sbjct: 282 GGPPPPPPP 290 Score = 39.9 bits (89), Expect = 0.005 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 4/99 (4%) Frame = +2 Query: 677 PPXPPPP----GPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP PPP GPP P P P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPP 286 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P PPP P PPR PP Sbjct: 287 PPPPLFMRRNGPGPGPMMGVPPP-MHMMGPRMPPRGIPP 324 Score = 37.5 bits (83), Expect = 0.027 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 1/75 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPX-PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P P P P P P P P P P P GP PP Sbjct: 226 PPPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPP 285 Query: 719 XXPPXXPXPXXXPXP 763 PP P P Sbjct: 286 PPPPPLFMRRNGPGP 300 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 7/83 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP-APPXPXXXXPXPXXP---PXPXPXPXXXXXXPPXPPP---AX 658 P P G P P PP P P P P P P P P P P P Sbjct: 248 PRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVP 307 Query: 659 PXPXXXPPXPPPPGPPXXPPXXP 727 P P PP G P P P Sbjct: 308 PPMHMMGPRMPPRGIPPVGPYGP 330 Score = 33.9 bits (74), Expect = 0.34 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 9/89 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA------XP 661 P P G P P P P P P P P PP PPP P Sbjct: 243 PMGPGPRGPGPMGPGGPYPQMPF----PPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGP 298 Query: 662 XPXXXPPXPPP---PGPPXXPPXXPPXXP 739 P PPP GP P PP P Sbjct: 299 GPGPMMGVPPPMHMMGPRMPPRGIPPVGP 327 >AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA protein. Length = 463 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP PP P P P P P P P P PP P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRG--PGPMGPGGPYPQ---MPFPPPVPGMRGPGPMGPM 281 Query: 680 PXPPPPGPP 706 PPPP PP Sbjct: 282 GGPPPPPPP 290 Score = 39.9 bits (89), Expect = 0.005 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 4/99 (4%) Frame = +2 Query: 677 PPXPPPP----GPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXX 844 PP PPP GPP P P P P P Sbjct: 227 PPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPP 286 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P P PPP P PPR PP Sbjct: 287 PPPPLFMRRNGPGPGPMMGVPPP-MHMMGPRMPPRGIPP 324 Score = 37.5 bits (83), Expect = 0.027 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 1/75 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPX-PXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P P P P P P P P P P P GP PP Sbjct: 226 PPPNRPPPRLMMGPPMGPMGPGPRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPP 285 Query: 719 XXPPXXPXPXXXPXP 763 PP P P Sbjct: 286 PPPPPLFMRRNGPGP 300 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 7/83 (8%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXP-APPXPXXXXPXPXXP---PXPXPXPXXXXXXPPXPPP---AX 658 P P G P P PP P P P P P P P P P P P Sbjct: 248 PRGPGPMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVP 307 Query: 659 PXPXXXPPXPPPPGPPXXPPXXP 727 P P PP G P P P Sbjct: 308 PPMHMMGPRMPPRGIPPVGPYGP 330 Score = 33.9 bits (74), Expect = 0.34 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 9/89 (10%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA------XP 661 P P G P P P P P P P P PP PPP P Sbjct: 243 PMGPGPRGPGPMGPGGPYPQMPF----PPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGP 298 Query: 662 XPXXXPPXPPP---PGPPXXPPXXPPXXP 739 P PPP GP P PP P Sbjct: 299 GPGPMMGVPPPMHMMGPRMPPRGIPPVGP 327 >AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA protein. Length = 172 Score = 43.6 bits (98), Expect = 4e-04 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +2 Query: 500 PPXXAPPXX--GXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXX 673 PP PP PPP P P P P P P P P P Sbjct: 60 PPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTY 119 Query: 674 XPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 PP PPPP P P P Sbjct: 120 LPPPPPPPRTTTTTTTTTTTTPAPTPVP 147 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 7/73 (9%) Frame = +2 Query: 548 PAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP-------PPGPP 706 P PP P P P P P P P P P P PP PP P P Sbjct: 56 PPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPT-PAPTYLPPPPPTTTTTTTTPAPT 114 Query: 707 XXPPXXPPXXPXP 745 P PP P P Sbjct: 115 PAPTYLPPPPPPP 127 Score = 40.7 bits (91), Expect = 0.003 Identities = 30/124 (24%), Positives = 31/124 (25%), Gaps = 2/124 (1%) Frame = +2 Query: 593 PPXPXPXPXXXXXXPPXPPPAXPXPXXXPP--XPPPPGPPXXPPXXPPXXPXPXXXPXPX 766 P P PP PPP P P PPPP P P P P P Sbjct: 42 PKPEIPFVITSTTEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPP- 100 Query: 767 AXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPP 946 PP P P P P PP PP Sbjct: 101 -----PPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPP 155 Query: 947 RPXP 958 +P P Sbjct: 156 QPEP 159 Score = 37.5 bits (83), Expect = 0.027 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 1/120 (0%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P PP P P PPP P P P P PP Sbjct: 42 PKPEIPFVITSTTEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTP-APTPAPTYLPP- 99 Query: 722 XPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXP-PXPXPXXPPXPAPXPXP 898 PP P P P P P P P P P P P Sbjct: 100 PPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQPEP 159 Score = 36.7 bits (81), Expect = 0.048 Identities = 28/111 (25%), Positives = 28/111 (25%) Frame = +1 Query: 538 PPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPRPXXPXXXXXXXXXXXXXXXXX 717 PPPP P P P P P PP P P P P Sbjct: 56 PPPPPPTYLP-PKPVPTYLPPPPPTTTTTTTTTPAPTPAP------TYLPPPPPTTTTTT 108 Query: 718 XXPXPXPGPPXXXXXXXXXXXXXXXXXXXXXXPPPPPPXPXXPPPPXPPXP 870 P P P P P P P PPPP P P Sbjct: 109 TTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQPEP 159 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 817 PPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PPPPP PP P P PP P P P P P Sbjct: 56 PPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPP 102 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPP-PXXXPPXPPPP 656 P+ P PP PPP PAP P P PP PP P Sbjct: 111 PAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 157 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSPPR 654 P PP P P P PP P P P P PP PPR Sbjct: 70 PTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPPR 128 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP PAP P P PP P P P P PP PP Sbjct: 100 PPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPV---PTYLPPPPPQ 156 Query: 695 PGP 703 P P Sbjct: 157 PEP 159 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAP---PPPXXXPPXPPP 653 P P+ PPP PP P P P P PPP PP P P Sbjct: 113 PTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPP---PPQPEP 159 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPP 653 P P P+ P PP PP P P P P PP P P Sbjct: 111 PAPTPAPTYL----PPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 157 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAP 951 PPPPP P P PPP P P PP P Sbjct: 57 PPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPP 102 >X12945-1|CAA31405.1| 661|Drosophila melanogaster vasa protein. Length = 661 Score = 43.2 bits (97), Expect = 5e-04 Identities = 33/93 (35%), Positives = 34/93 (36%), Gaps = 8/93 (8%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXX------GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 A G G G GG GG GG GGG GG G GG GG Sbjct: 35 AEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGGRREGERDFR 94 Query: 606 XGXGG-XXGXGXXXXGXGGA-GXGGGXXPXXGG 514 G GG G G G GG+ G GG GG Sbjct: 95 GGEGGFRGGQGGSRGGQGGSRGGQGGFRGGEGG 127 Score = 40.7 bits (91), Expect = 0.003 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGG GG G GGG GG G GG G G Sbjct: 33 GEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHG-GRREGER 91 Query: 558 GGAGXGGGXXPXXGGAXXG 502 G GG GG+ G Sbjct: 92 DFRGGEGGFRGGQGGSRGG 110 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G GG G R GGG GG GG G GGG Sbjct: 33 GEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGG 81 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGG GG GG GGG G GG GG GG G Sbjct: 62 GGGRGGGAGG-YRGGNRDGGGFHGGRREGERDFRGGEGGFRGGQGGSRG 109 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G GG GGG GG GG G G GG Sbjct: 37 GDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGG 85 Score = 29.1 bits (62), Expect = 9.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G G G GGG GG GG Sbjct: 42 GSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGG 80 >M71251-1|AAA28503.1| 159|Drosophila melanogaster EDG-91 protein. Length = 159 Score = 43.2 bits (97), Expect = 5e-04 Identities = 30/79 (37%), Positives = 32/79 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG G G G GG G GGG G G G GG G G Sbjct: 32 GLLGGGFGGSVGLSAGIGVGGGLYS-GFGGGGYPGGYASGYPGGYG-GGYSGYN----GY 85 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG+G GGG P G + G Sbjct: 86 GGSGFGGGYYPGGGYSGFG 104 Score = 42.3 bits (95), Expect = 0.001 Identities = 34/93 (36%), Positives = 35/93 (37%), Gaps = 6/93 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGX-GGXXXGX-GXAGGGXGGXXXXXX-GXGXGX-- 598 G G G G GG G GGGG GG G G GGG G G G G Sbjct: 37 GFGGSVGLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYP 96 Query: 597 -GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 GG G G GG GGG GG+ G Sbjct: 97 GGGYSGFGHRPHYHGGYYPGGGSYHNQGGSYGG 129 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G GG G G GG G G GGG G G G G G Sbjct: 43 GLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPG 97 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG---GGG 813 G G G G G G GGG G G G G GGG GGG Sbjct: 47 GIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPGGG 99 >M71250-1|AAA28502.1| 159|Drosophila melanogaster EDG-91 protein. Length = 159 Score = 43.2 bits (97), Expect = 5e-04 Identities = 30/79 (37%), Positives = 32/79 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG G G G GG G GGG G G G GG G G Sbjct: 32 GLLGGGFGGSVGLSAGIGVGGGLYS-GFGGGGYPGGYASGYPGGYG-GGYSGYN----GY 85 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG+G GGG P G + G Sbjct: 86 GGSGFGGGYYPGGGYSGFG 104 Score = 42.3 bits (95), Expect = 0.001 Identities = 34/93 (36%), Positives = 35/93 (37%), Gaps = 6/93 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGX-GGXXXGX-GXAGGGXGGXXXXXX-GXGXGX-- 598 G G G G GG G GGGG GG G G GGG G G G G Sbjct: 37 GFGGSVGLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYP 96 Query: 597 -GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 GG G G GG GGG GG+ G Sbjct: 97 GGGYSGFGHRPHYHGGYYPGGGSYHNQGGSYGG 129 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G GG G G GG G G GGG G G G G G Sbjct: 43 GLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPG 97 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG---GGG 813 G G G G G G GGG G G G G GGG GGG Sbjct: 47 GIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPGGG 99 >BT003569-1|AAO39573.1| 745|Drosophila melanogaster LD44990p protein. Length = 745 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG GG GG GGG G G AGGG G G G G G G Sbjct: 400 GGASAGGGAGGG-GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSS 458 Query: 564 GXGGAGXGG 538 +G G Sbjct: 459 SASSSGISG 467 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GG AGGG G GA G G GGG Sbjct: 412 GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 454 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG G GGA G GA G GG G G G Sbjct: 406 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 454 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GG G GGGG GG A G GG G G G G Sbjct: 400 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 446 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GG GGG A GG G G G GG Sbjct: 405 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 444 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GG G GG G G G G G Sbjct: 401 GASAGGGAGG---GGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 452 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GG G GG GG G GA G GG G G G G Sbjct: 400 GGASAGG---GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 448 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG---GGXAGXGXGAGXGGXXGXGXG 847 GG G GG G GG GG AG G GAG G G Sbjct: 406 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 446 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GGP GGG G G G G Sbjct: 407 GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 448 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG-GXGGGGXXGXGGG---GGG 813 GA G G G GG G GGG G G G G G G GGG Sbjct: 401 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 454 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG + G G GG G G GG G G G GG G Sbjct: 399 AGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 446 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G AGG G Sbjct: 405 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 448 >BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p protein. Length = 195 Score = 43.2 bits (97), Expect = 5e-04 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P PP P P PP PPP P PP P P P P Sbjct: 28 PLYPPGYYPIYALPPPQGPPYPAP--------PPPPPPFQPIGPLIPPQPALPSTPAVIP 79 Query: 719 XXPPXXPXPXXXPXP 763 P P P P Sbjct: 80 TFQPTPPNPQTPVTP 94 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP P P P P P P PP P P Sbjct: 41 PPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTP 91 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXP-----XPPXPPXPXPXXXXXXXPPSPPRPXX 663 PP P P PP P PP P P PP P P P+PP P Sbjct: 31 PPGYYPIYALPPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQT 90 Query: 664 P 666 P Sbjct: 91 P 91 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P P P P P P P P P P Sbjct: 41 PPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTP 94 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PPP PP P P P P P P PP P P P Sbjct: 46 PPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTP 94 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PPPP P PP+P P Sbjct: 42 PPQGPPYPAPPPPPPPFQPIGPLIPPQPALP 72 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP PAP P P P P PP P P P Sbjct: 41 PPPQGPPYPAPPPPPP-PFQPIGPLIPPQPALPSTP 75 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP-----PX-PPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP PP P PPPP P P PP P PP P P P Sbjct: 42 PPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTPP 95 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP-PPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP P PPP PP P PP P P P PA P Sbjct: 31 PPGYYPIYALPPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIP 79 Score = 29.5 bits (63), Expect = 7.2 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP-XPXXXP---PXPPPPGPP 706 PP PP P PP P P P P PA P P P P PP P P Sbjct: 41 PPPQGPPYPA--------PP-PPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTP 91 Query: 707 XXPP 718 PP Sbjct: 92 VTPP 95 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 537 PPPXPPX--PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PPP PP PP P P PPP PPP PPPP Sbjct: 385 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P PP P P PP PPP P PPPP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGV----PPAPPPMPVFGAGGAP-PPPPPPSSGMAG 421 Query: 722 XPPXXPXPXXXP 757 PP P P Sbjct: 422 VPPPPPMQKSQP 433 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P PP P AP P PPP P P PPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 Score = 37.9 bits (84), Expect = 0.021 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP G PPP PAPP PP P P P P PPP P Sbjct: 372 PPPPTAASVGVPPPP-PAPPA--------GVPPAPPPMPVFGAGGAPPPPP--PPSSGMA 420 Query: 680 PXPPPP 697 PPPP Sbjct: 421 GVPPPP 426 Score = 36.3 bits (80), Expect = 0.063 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P A P P PP P PP PP P PP P G PP Sbjct: 355 PLSAQKTQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPA---PPPMPVFGAGGAPPP 411 Query: 722 XPPXXPXPXXXPXP 763 PP P P Sbjct: 412 PPPPSSGMAGVPPP 425 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P PP P P P PP P PP PPP PP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVP-PAPPPMPV---FGAGGAPPPPPPPSSGMAGVPP 424 Query: 683 XPP 691 PP Sbjct: 425 PPP 427 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR---PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P P PP P PP P PP P P PP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Query: 649 P 651 P Sbjct: 427 P 427 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +2 Query: 539 PPXPAPP-------XPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 P P PP P P PP P P P P PPP P PPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +1 Query: 814 PPPP-------PPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPP PP P PP PP PPP PP P PP+ Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGG-------APPPPPPPS 416 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P PPPP P P P P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 401 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP------XPAXPPPP--XXXXXPPXPP 946 PP P PP P P P P PPPP PP PP Sbjct: 386 PPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P PP A P PP P P PP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 401 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP P PA PP P PP P P Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 869 PPXPAPXPX-PAXPPPPXXXXXPPXPPRPXPP 961 PP PAP P PPP PP P PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 890 PXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP PP P PP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPP 390 >AY052042-1|AAK93466.1| 1193|Drosophila melanogaster LP05220p protein. Length = 1193 Score = 43.2 bits (97), Expect = 5e-04 Identities = 44/171 (25%), Positives = 45/171 (26%), Gaps = 25/171 (14%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP- 691 PP G PP P P P P P P P PP A P P PP Sbjct: 207 PPLPGQ--PPLPGQPPFSGQIPTSQPAPSPYGVPSSRPGQPQLPPGATPPTYTQPGLPPQ 264 Query: 692 ---------PPGPPXXPPXXPPXXP------XPXXXPXPXAXXXXXXXXXXXXXXXXXXX 826 PG P P PP P P P P A Sbjct: 265 QQQGIPPLQQPGIPQQQPGFPPQQPGLPPLSQPGLPPQPGAPYGAPQQGGYSGGFPGQAP 324 Query: 827 XXXXXXPP--------XPXPXXPPXPA-PXPXPAXPPPPXXXXXPPXPPRP 952 PP P P P P P PP P P PP+P Sbjct: 325 GGFPGAPPPLPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQPMPGYPPQP 375 Score = 42.7 bits (96), Expect = 7e-04 Identities = 46/175 (26%), Positives = 47/175 (26%), Gaps = 24/175 (13%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX---PXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPA 655 P PP G P PAP P P PP P PP PP Sbjct: 214 PLPGQPPFSGQIPTSQPAPSPYGVPSSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQ 273 Query: 656 XPX-PXXXPPXPPP-PG-PPXXPPXXPPXXPXPXXXPX------------PXAXXXXXXX 790 P P P PP PG PP P PP P P P Sbjct: 274 QPGIPQQQPGFPPQQPGLPPLSQPGLPPQPGAPYGAPQQGGYSGGFPGQAPGGFPGAPPP 333 Query: 791 XXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPP-XXXXXPPXPPRP 952 P P PP P P P PP P P PP+P Sbjct: 334 LPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388 Score = 38.7 bits (86), Expect = 0.012 Identities = 36/134 (26%), Positives = 36/134 (26%), Gaps = 1/134 (0%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP A P PP PA P P PP P P P PA P P P Sbjct: 183 PPKAATPGAAPGQPPIPAA-GSTSQPPLPGQPPLPGQPPFSGQI--PTSQPA-PSPYGVP 238 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 PG P PP P P PP Sbjct: 239 --SSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFPPQQPGLPPLSQ 296 Query: 860 PXXPPXP-APXPXP 898 P PP P AP P Sbjct: 297 PGLPPQPGAPYGAP 310 Score = 34.3 bits (75), Expect = 0.25 Identities = 31/132 (23%), Positives = 32/132 (24%), Gaps = 6/132 (4%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P PP P P PP PG P P P P P Sbjct: 179 PHMPPPKAATPGAAPGQPPIPAAGSTSQPPLPGQPPLPGQPPFSGQIPTSQP----APSP 234 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPP-PPXXXXXPP- 937 PP PP P P PP PP Sbjct: 235 YGVPSSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFPPQQPGLPPL 294 Query: 938 ----XPPRPXPP 961 PP+P P Sbjct: 295 SQPGLPPQPGAP 306 Score = 34.3 bits (75), Expect = 0.25 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +2 Query: 503 PXXAPPXXGXXP--PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P PP G PP P P P PP P P PP P P Sbjct: 328 PGAPPPLPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQP--MPGYPPQPGQQLGGPGYP 385 Query: 677 P-PXPPPPGPPXXPPXXPPXXP 739 P P PG P P P P Sbjct: 386 PQPGAGFPGQPGRPGFNQPPMP 407 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P P +P PP P P P PP P PP P Sbjct: 350 PGYPGQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388 Score = 31.9 bits (69), Expect = 1.4 Identities = 31/134 (23%), Positives = 31/134 (23%), Gaps = 2/134 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PA-XPXPXXXPPXPPPPGPPXXP 715 P PP P PP P P PP P P P P P P P Sbjct: 179 PHMPPPKAATPGAAPGQPPIPAAGSTSQPPLPGQPPLPGQPPFSGQIPTSQPAPSPYGVP 238 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPX 895 P P P P P P P P P Sbjct: 239 SSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFP-PQQPGLP-PLSQ 296 Query: 896 PAXPPPPXXXXXPP 937 P PP P P Sbjct: 297 PGLPPQPGAPYGAP 310 >AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p protein. Length = 349 Score = 43.2 bits (97), Expect = 5e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG-----GGGGG 813 G GG G GG G GGG GG GGGG G G GGGGG Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGG 73 Score = 38.3 bits (85), Expect = 0.016 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 GG GG GGGG GG GGG G G G G GG Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGGG+ + G GGG GG GGG Sbjct: 23 GGGGGGG---GGGGSKTTYNVIATPSSGGGGGGGGGGGGG 59 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGGG GGG G G G G G G G Sbjct: 47 GGGGGGG---GGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG GG +GGG GG G G G GG G G GG G Sbjct: 25 GGGGGGGGGSKTTYNVIATPSSGGGGGG------GGGGGGGGGHGYSYAQGGGGGHGYAQ 78 Query: 537 G 535 G Sbjct: 79 G 79 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG GGG A GG GG GGG G G Sbjct: 26 GGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHG 63 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAG-----GGXGXXXXXGAXGXGGGXGG 548 GGGG GG GGGG G GG G G G G GG Sbjct: 48 GGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 11/62 (17%) Frame = -2 Query: 664 GXXGGGGXGGXXX-----------GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG GG GGGG GGG G G GG GG G G Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 517 XG 512 G Sbjct: 84 HG 85 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G GG GG GGGG G G GGG G G G G G G + Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQG-GGGGHGYAQGHGYGHGHGGSPQIIKVILQEGQGYSN 105 Query: 546 XGG 538 GG Sbjct: 106 AGG 108 Score = 33.9 bits (74), Expect = 0.34 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 10/115 (8%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXG------GGGXAGXGXGAGXGGXXG----XGXGGXXXXXXXXXXX 811 GG G GG GG GG G G G G GG G G GG Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 810 XXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG 646 G G G GG G G G G G GG Sbjct: 84 HGHGGSPQIIKVILQEGQGYSNAGGSAGGIVSSEGHGYSHGHGHGYASGHGSYGG 138 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 640 GGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GGGG G GGG GG GGG G G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQG 69 Score = 32.7 bits (71), Expect = 0.77 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 6/67 (8%) Frame = -3 Query: 744 GXGXXGGXXGGXX------GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG GG P GG GG G G GGG G G G G G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGG-GGGGGGGGGHGYSYAQGGGGGHGYAQGHG 81 Query: 582 XGXXXXG 562 G G Sbjct: 82 YGHGHGG 88 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GG GG GGG GG + G G G GG Sbjct: 301 GGSKGGWGSGGGAISGGWSSGGGAASGGWSSGGGAASGG 339 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G GG G GG GG G G A GG Sbjct: 302 GSKGGWGSGGGAISGGWSSGGGAASGGWSSGGGAASGG 339 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GG G GG GG + GG G + G G GG G Sbjct: 302 GSKGGWGSGGGAISGGWSSGG-GAASGGWSSGGGAASGGWSSG 343 Score = 29.5 bits (63), Expect = 7.2 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG GG G G G G GG G G G GG G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGG---GGGGGGGGGHGYSYAQGGGGGHG 75 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 A +GG G GG G + GGG G G G G GG Sbjct: 42 ATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 >AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-PD, isoform D protein. Length = 1470 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG GG GG GGG G G AGGG G G G G G G Sbjct: 1125 GGASAGGGAGGG-GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSS 1183 Query: 564 GXGGAGXGG 538 +G G Sbjct: 1184 SASSSGISG 1192 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GG AGGG G GA G G GGG Sbjct: 1137 GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG G GGA G GA G GG G G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GG G GGGG GG A G GG G G G G Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GG GGG A GG G G G GG Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 1169 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GG G GG G G G G G Sbjct: 1126 GASAGGGAGG---GGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 1177 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GG G GG GG G GA G GG G G G G Sbjct: 1125 GGASAGG---GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGG 602 G GGGG GG GGG +GGG Sbjct: 824 GECGGGGAGGSGGGGGASGGG 844 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG GGG G Sbjct: 828 GGGAGGSGGGGGASGGGGASG 848 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG---GGXAGXGXGAGXGGXXGXGXG 847 GG G GG G GG GG AG G GAG G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GGP GGG G G G G Sbjct: 1132 GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG-GXGGGGXXGXGGG---GGG 813 GA G G G GG G GGG G G G G G G GGG Sbjct: 1126 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG + G G GG G G GG G G G GG G Sbjct: 1124 AGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GG GG G GG G GG GG Sbjct: 823 GGECGGGGAGGSGGGGGASGG 843 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 GG GG G G GG GG G G +G G Sbjct: 823 GGECGGGGAG-GSGGGGGASGGGGASGAG 850 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGG 605 G GG G GG GGGGA G Sbjct: 829 GGAGGSGGGGGASGGGGASG 848 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G AGG G Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 29.5 bits (63), Expect = 7.2 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 637 GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXG 542 G GGGGAGG G GA G GGG G G Sbjct: 823 GGECGGGGAGGSGG---GGGASG-GGGASGAG 850 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 GG GG G GG GG G GGG G Sbjct: 823 GGECGGGGAGGSGGG--GGASGGGGASG 848 >AE014298-1795|AAF48187.3| 1470|Drosophila melanogaster CG17762-PC, isoform C protein. Length = 1470 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG GG GG GGG G G AGGG G G G G G G Sbjct: 1125 GGASAGGGAGGG-GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSS 1183 Query: 564 GXGGAGXGG 538 +G G Sbjct: 1184 SASSSGISG 1192 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GG AGGG G GA G G GGG Sbjct: 1137 GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG G GGA G GA G GG G G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GG G GGGG GG A G GG G G G G Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GG GGG A GG G G G GG Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 1169 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GG G GG G G G G G Sbjct: 1126 GASAGGGAGG---GGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 1177 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GG G GG GG G GA G GG G G G G Sbjct: 1125 GGASAGG---GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG---GGXAGXGXGAGXGGXXGXGXG 847 GG G GG G GG GG AG G GAG G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GGP GGG G G G G Sbjct: 1132 GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG-GXGGGGXXGXGGG---GGG 813 GA G G G GG G GGG G G G G G G GGG Sbjct: 1126 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG + G G GG G G GG G G G GG G Sbjct: 1124 AGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 1171 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G AGG G Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 >AE014298-1794|AAF48188.3| 1173|Drosophila melanogaster CG17762-PB, isoform B protein. Length = 1173 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG GG GG GGG G G AGGG G G G G G G Sbjct: 828 GGASAGGGAGGG-GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSS 886 Query: 564 GXGGAGXGG 538 +G G Sbjct: 887 SASSSGISG 895 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GG AGGG G GA G G GGG Sbjct: 840 GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG G GGA G GA G GG G G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GG G GGGG GG A G GG G G G G Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GG GGG A GG G G G GG Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 872 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GG G GG G G G G G Sbjct: 829 GASAGGGAGG---GGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 880 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GG G GG GG G GA G GG G G G G Sbjct: 828 GGASAGG---GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG---GGXAGXGXGAGXGGXXGXGXG 847 GG G GG G GG GG AG G GAG G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GGP GGG G G G G Sbjct: 835 GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG-GXGGGGXXGXGGG---GGG 813 GA G G G GG G GGG G G G G G G GGG Sbjct: 829 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG + G G GG G G GG G G G GG G Sbjct: 827 AGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G AGG G Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 >AE014298-1793|AAF48190.3| 1173|Drosophila melanogaster CG17762-PA, isoform A protein. Length = 1173 Score = 43.2 bits (97), Expect = 5e-04 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXX 565 G GG GG GG GGG G G AGGG G G G G G G Sbjct: 828 GGASAGGGAGGG-GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSS 886 Query: 564 GXGGAGXGG 538 +G G Sbjct: 887 SASSSGISG 895 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGG G GG AGGG G GA G G GGG Sbjct: 840 GGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 36.7 bits (81), Expect = 0.048 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG G GGA G GA G GG G G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GG G GGGG GG A G GG G G G G Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 36.3 bits (80), Expect = 0.063 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGG GG GGG A GG G G G GG Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 872 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G GGG GG GGG GG G GG G G G G G Sbjct: 829 GASAGGGAGG---GGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 880 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GG G GG GG G GA G GG G G G G Sbjct: 828 GGASAGG---GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGG---GGXAGXGXGAGXGGXXGXGXG 847 GG G GG G GG GG AG G GAG G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXG 637 G G G G G GGP GGG G G G G Sbjct: 835 GAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXG-GXGGGGXXGXGGG---GGG 813 GA G G G GG G GGG G G G G G G GGG Sbjct: 829 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 AG + G G GG G G GG G G G GG G Sbjct: 827 AGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVG 874 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 762 GXGXXXGXGXXGGXX-GGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G G G GG GG G GG G G AGG G Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 >AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA protein. Length = 349 Score = 43.2 bits (97), Expect = 5e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXG-----GGGGG 813 G GG G GG G GGG GG GGGG G G GGGGG Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGG 73 Score = 38.3 bits (85), Expect = 0.016 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 GG GG GGGG GG GGG G G G G GG Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGGG+ + G GGG GG GGG Sbjct: 23 GGGGGGG---GGGGSKTTYNVIATPSSGGGGGGGGGGGGG 59 Score = 37.9 bits (84), Expect = 0.021 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGGG GGG G G G G G G G Sbjct: 47 GGGGGGG---GGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -3 Query: 717 GGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGG 538 GG GG GG +GGG GG G G G GG G G GG G Sbjct: 25 GGGGGGGGGSKTTYNVIATPSSGGGGGG------GGGGGGGGGHGYSYAQGGGGGHGYAQ 78 Query: 537 G 535 G Sbjct: 79 G 79 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG GGG A GG GG GGG G G Sbjct: 26 GGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHG 63 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAG-----GGXGXXXXXGAXGXGGGXGG 548 GGGG GG GGGG G GG G G G G GG Sbjct: 48 GGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 Score = 34.3 bits (75), Expect = 0.25 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 11/62 (17%) Frame = -2 Query: 664 GXXGGGGXGGXXX-----------GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGGG GG GGGG GGG G G GG GG G G Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 517 XG 512 G Sbjct: 84 HG 85 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G GG GG GGGG G G GGG G G G G G G + Sbjct: 47 GGGGGGGGGGGGGGGHGYSYAQG-GGGGHGYAQGHGYGHGHGGSPQIIKVILQEGQGYSN 105 Query: 546 XGG 538 GG Sbjct: 106 AGG 108 Score = 33.9 bits (74), Expect = 0.34 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 10/115 (8%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXG------GGGXAGXGXGAGXGGXXG----XGXGGXXXXXXXXXXX 811 GG G GG GG GG G G G G GG G G GG Sbjct: 24 GGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYG 83 Query: 810 XXXXXXXXXXXXXGAXGXGXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGG 646 G G G GG G G G G G GG Sbjct: 84 HGHGGSPQIIKVILQEGQGYSNAGGSAGGIVSSEGHGYSHGHGHGYASGHGSYGG 138 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 640 GGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GG GGGG G GGG GG GGG G G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGGGGGGGGGGGHGYSYAQG 69 Score = 32.7 bits (71), Expect = 0.77 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 6/67 (8%) Frame = -3 Query: 744 GXGXXGGXXGGXX------GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXG 583 G G GG GG P GG GG G G GGG G G G G G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGG-GGGGGGGGGHGYSYAQGGGGGHGYAQGHG 81 Query: 582 XGXXXXG 562 G G Sbjct: 82 YGHGHGG 88 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 652 GGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GG GG GGG GG + G G G GG Sbjct: 301 GGSKGGWGSGGGAISGGWSSGGGAASGGWSSGGGAASGG 339 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 756 GXXXGXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGG 643 G G G GG G GG GG G G A GG Sbjct: 302 GSKGGWGSGGGAISGGWSSGGGAASGGWSSGGGAASGG 339 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GG G GG GG + GG G + G G GG G Sbjct: 302 GSKGGWGSGGGAISGGWSSGG-GAASGGWSSGGGAASGGWSSG 343 Score = 29.5 bits (63), Expect = 7.2 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 666 GXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GGG GG G G G G GG G G G GG G Sbjct: 23 GGGGGGGGGGGSKTTYNVIATPSSGGGGGG---GGGGGGGGGHGYSYAQGGGGGHG 75 Score = 29.1 bits (62), Expect = 9.5 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -1 Query: 959 AGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGG 819 A +GG G GG G + GGG G G G G GG Sbjct: 42 ATPSSGGGGGGGGGGGGGGGHGYSYAQGGGGGHGYAQGHGYGHGHGG 88 >AE014297-2375|AAF55440.1| 159|Drosophila melanogaster CG7539-PA protein. Length = 159 Score = 43.2 bits (97), Expect = 5e-04 Identities = 30/79 (37%), Positives = 32/79 (40%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G GG GG G G G GG G GGG G G G GG G G Sbjct: 32 GLLGGGFGGSVGLSAGIGVGGGLYS-GFGGGGYPGGYASGYPGGYG-GGYSGYN----GY 85 Query: 558 GGAGXGGGXXPXXGGAXXG 502 GG+G GGG P G + G Sbjct: 86 GGSGFGGGYYPGGGYSGFG 104 Score = 42.7 bits (96), Expect = 7e-04 Identities = 34/93 (36%), Positives = 35/93 (37%), Gaps = 6/93 (6%) Frame = -3 Query: 762 GXGXXXGXGXXGGXXGGXXGGPGGGGX-GGXXXGX-GXAGGGXGGXXXXXX-GXGXGX-- 598 G G G G GG G GGGG GG G G GGG G G G G Sbjct: 37 GFGGSVGLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYP 96 Query: 597 -GGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 GG G G GG GGG GG+ G Sbjct: 97 GGGYSGFGHRPHHHGGYYPGGGSYHNQGGSYGG 129 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 G G G GG G G GG G G GGG G G G G G Sbjct: 43 GLSAGIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPG 97 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGG---GGG 813 G G G G G G GGG G G G G GGG GGG Sbjct: 47 GIGVGGGLYSGFGGGGYPGGYASGYPGGYGGGYSGYNGYGGSGFGGGYYPGGG 99 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 537 PPPXPPX--PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PPP PP PP P P PPP PPP PPPP Sbjct: 385 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P PP P P PP PPP P PPPP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGV----PPAPPPMPVFGAGGAP-PPPPPPSSGMAG 421 Query: 722 XPPXXPXPXXXP 757 PP P P Sbjct: 422 VPPPPPMQKSQP 433 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P PP P AP P PPP P P PPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 Score = 37.9 bits (84), Expect = 0.021 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP G PPP PAPP PP P P P P PPP P Sbjct: 372 PPPPTAASVGVPPPP-PAPPA--------GVPPAPPPMPVFGAGGAPPPPP--PPSSGMA 420 Query: 680 PXPPPP 697 PPPP Sbjct: 421 GVPPPP 426 Score = 36.3 bits (80), Expect = 0.063 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P A P P PP P PP PP P PP P G PP Sbjct: 355 PLSAQKTQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPA---PPPMPVFGAGGAPPP 411 Query: 722 XPPXXPXPXXXPXP 763 PP P P Sbjct: 412 PPPPSSGMAGVPPP 425 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P PP P P P PP P PP PPP PP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVP-PAPPPMPV---FGAGGAPPPPPPPSSGMAGVPP 424 Query: 683 XPP 691 PP Sbjct: 425 PPP 427 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR---PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P P PP P PP P PP P P PP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Query: 649 P 651 P Sbjct: 427 P 427 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +2 Query: 539 PPXPAPP-------XPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 P P PP P P PP P P P P PPP P PPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +1 Query: 814 PPPP-------PPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPP PP P PP PP PPP PP P PP+ Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGG-------APPPPPPPS 416 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P PPPP P P P P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 401 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP------XPAXPPPP--XXXXXPPXPP 946 PP P PP P P P P PPPP PP PP Sbjct: 386 PPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P PP A P PP P P PP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 401 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP P PA PP P PP P P Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 869 PPXPAPXPX-PAXPPPPXXXXXPPXPPRPXPP 961 PP PAP P PPP PP P PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 890 PXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP PP P PP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPP 390 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 537 PPPXPPX--PPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 PPP PP PP P P PPP PPP PPPP Sbjct: 501 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P P P P PP P P PP PPP P PPPP P Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGV----PPAPPPMPVFGAGGAP-PPPPPPSSGMAG 537 Query: 722 XPPXXPXPXXXP 757 PP P P Sbjct: 538 VPPPPPMQKSQP 549 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P PP P AP P PPP P P PPPP Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 Score = 37.9 bits (84), Expect = 0.021 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP G PPP PAPP PP P P P P PPP P Sbjct: 488 PPPPTAASVGVPPPP-PAPPA--------GVPPAPPPMPVFGAGGAPPPPP--PPSSGMA 536 Query: 680 PXPPPP 697 PPPP Sbjct: 537 GVPPPP 542 Score = 36.3 bits (80), Expect = 0.063 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPX 721 P A P P PP P PP PP P PP P G PP Sbjct: 471 PLSAQKTQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPA---PPPMPVFGAGGAPPP 527 Query: 722 XPPXXPXPXXXPXP 763 PP P P Sbjct: 528 PPPPSSGMAGVPPP 541 Score = 36.3 bits (80), Expect = 0.063 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P PP P PP P P P PP P PP PPP PP Sbjct: 485 PVSPPPPTAASVGVPPPPPAPPAGVP-PAPPPMPV---FGAGGAPPPPPPPSSGMAGVPP 540 Query: 683 XPP 691 PP Sbjct: 541 PPP 543 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +1 Query: 478 PXXXXXXPPXXXPXXXXXPXPPPPR---PXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P PP P P PP P PP P PP P P PP P Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 Query: 649 P 651 P Sbjct: 543 P 543 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +2 Query: 539 PPXPAPP-------XPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 P P PP P P PP P P P P PPP P PPP Sbjct: 485 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +1 Query: 814 PPPP-------PPXPXXPPPPXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPA 948 PPPP PP P PP PP PPP PP P PP+ Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGG-------APPPPPPPS 532 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP P PPPP P P P P Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 517 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 8/42 (19%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXP------XPAXPPPP--XXXXXPPXPP 946 PP P PP P P P P PPPP PP PP Sbjct: 502 PPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 848 PXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRP 952 P P PP A P PP P P PP P Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMP 517 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P PP P PA PP P PP P P Sbjct: 499 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 29.5 bits (63), Expect = 7.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 869 PPXPAPXPX-PAXPPPPXXXXXPPXPPRPXPP 961 PP PAP P PPP PP P PP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 29.1 bits (62), Expect = 9.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 890 PXPAXPPPPXXXXXPPXPPRPXPP 961 P P PPPP PP P PP Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPP 506 >AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA protein. Length = 575 Score = 43.2 bits (97), Expect = 5e-04 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPP 718 P P P P P PP P P PP PPP P PP P P P P Sbjct: 28 PLYPPGYYPIYALPPPQGPPYPAP--------PPPPPPFQPIGPLIPPQPALPSTPAVIP 79 Query: 719 XXPPXXPXPXXXPXP 763 P P P P Sbjct: 80 TFQPTPPNPQTPVTP 94 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P P P PP PP P P P P P P PP P P Sbjct: 41 PPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTP 91 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 499 PPXXXPXXXXXPXPPPPRPXXPPXPXPXP-----XPPXPPXPXPXXXXXXXPPSPPRPXX 663 PP P P PP P PP P P PP P P P+PP P Sbjct: 31 PPGYYPIYALPPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQT 90 Query: 664 P 666 P Sbjct: 91 P 91 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP 661 PP PP PPP P P P P P P P P P P Sbjct: 41 PPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTP 94 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 519 PSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P PPP PP P P P P P P PP P P P Sbjct: 46 PPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTP 94 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 869 PPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 PP P P P PPPP P PP+P P Sbjct: 42 PPQGPPYPAPPPPPPPFQPIGPLIPPQPALP 72 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 854 PXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXPP 961 P P PP PAP P P P P PP P P P Sbjct: 41 PPPQGPPYPAPPPPPP-PFQPIGPLIPPQPALPSTP 75 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXP-----PX-PPPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP PP P PPPP P P PP P PP P P P Sbjct: 42 PPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTPVTPP 95 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 814 PPPPPPXPXXPPPPXPPXP-PPXXXXXXXXXXXXXXPXPPXPXPPAPXP 957 PP P PPP PP P PP P P P PA P Sbjct: 31 PPGYYPIYALPPPQGPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIP 79 Score = 29.5 bits (63), Expect = 7.2 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +2 Query: 539 PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXP-XPXXXP---PXPPPPGPP 706 PP PP P PP P P P P PA P P P P PP P P Sbjct: 41 PPPQGPPYPA--------PP-PPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPPNPQTP 91 Query: 707 XXPP 718 PP Sbjct: 92 VTPP 95 >AE014134-2564|AAF53438.1| 661|Drosophila melanogaster CG3506-PA protein. Length = 661 Score = 43.2 bits (97), Expect = 5e-04 Identities = 33/93 (35%), Positives = 34/93 (36%), Gaps = 8/93 (8%) Frame = -3 Query: 768 AXGXGXXXGXGXXGGXXGGXX------GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXG 607 A G G G GG GG GG GGG GG G GG GG Sbjct: 35 AEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGGRREGERDFR 94 Query: 606 XGXGG-XXGXGXXXXGXGGA-GXGGGXXPXXGG 514 G GG G G G GG+ G GG GG Sbjct: 95 GGEGGFRGGQGGSRGGQGGSRGGQGGFRGGEGG 127 Score = 40.7 bits (91), Expect = 0.003 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGX 559 G G G GG GGG GG G GGG GG G GG G G Sbjct: 33 GEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHG-GRREGER 91 Query: 558 GGAGXGGGXXPXXGGAXXG 502 G GG GG+ G Sbjct: 92 DFRGGEGGFRGGQGGSRGG 110 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G GG G R GGG GG GG G GGG Sbjct: 33 GEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGG 81 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 664 GXXGGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 G GGG GG GG GGG G GG GG GG G Sbjct: 62 GGGRGGGAGG-YRGGNRDGGGFHGGRREGERDFRGGEGGFRGGQGGSRG 109 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 G G G G GG GGG GG GG G G GG Sbjct: 37 GDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGG 85 Score = 29.1 bits (62), Expect = 9.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G GG G G G G GGG GG GG Sbjct: 42 GSGGEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGG 80 >AE014134-368|AAF51283.2| 1193|Drosophila melanogaster CG10882-PA protein. Length = 1193 Score = 43.2 bits (97), Expect = 5e-04 Identities = 44/171 (25%), Positives = 45/171 (26%), Gaps = 25/171 (14%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPP- 691 PP G PP P P P P P P P PP A P P PP Sbjct: 207 PPLPGQ--PPLPGQPPFSGQIPTSQPAPSPYGVPSSRPGQPQLPPGATPPTYTQPGLPPQ 264 Query: 692 ---------PPGPPXXPPXXPPXXP------XPXXXPXPXAXXXXXXXXXXXXXXXXXXX 826 PG P P PP P P P P A Sbjct: 265 QQQGIPPLQQPGIPQQQPGFPPQQPGLPPLSQPGLPPQPGAPYGAPQQGGYSGGFPGQAP 324 Query: 827 XXXXXXPP--------XPXPXXPPXPA-PXPXPAXPPPPXXXXXPPXPPRP 952 PP P P P P P PP P P PP+P Sbjct: 325 GGFPGAPPPLPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQPMPGYPPQP 375 Score = 42.7 bits (96), Expect = 7e-04 Identities = 46/175 (26%), Positives = 47/175 (26%), Gaps = 24/175 (13%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPX---PXXXXPXPXXPPXPXPXPXXXXXXPPX-----PPPA 655 P PP G P PAP P P PP P PP PP Sbjct: 214 PLPGQPPFSGQIPTSQPAPSPYGVPSSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQ 273 Query: 656 XPX-PXXXPPXPPP-PG-PPXXPPXXPPXXPXPXXXPX------------PXAXXXXXXX 790 P P P PP PG PP P PP P P P Sbjct: 274 QPGIPQQQPGFPPQQPGLPPLSQPGLPPQPGAPYGAPQQGGYSGGFPGQAPGGFPGAPPP 333 Query: 791 XXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPP-XXXXXPPXPPRP 952 P P PP P P P PP P P PP+P Sbjct: 334 LPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388 Score = 38.7 bits (86), Expect = 0.012 Identities = 36/134 (26%), Positives = 36/134 (26%), Gaps = 1/134 (0%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP A P PP PA P P PP P P P PA P P P Sbjct: 183 PPKAATPGAAPGQPPIPAA-GSTSQPPLPGQPPLPGQPPFSGQI--PTSQPA-PSPYGVP 238 Query: 680 PXPPPPGPPXXPPXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPX 859 PG P PP P P PP Sbjct: 239 --SSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFPPQQPGLPPLSQ 296 Query: 860 PXXPPXP-APXPXP 898 P PP P AP P Sbjct: 297 PGLPPQPGAPYGAP 310 Score = 34.3 bits (75), Expect = 0.25 Identities = 31/132 (23%), Positives = 32/132 (24%), Gaps = 6/132 (4%) Frame = +2 Query: 584 PXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P PP P PP P P PP PG P P P P P Sbjct: 179 PHMPPPKAATPGAAPGQPPIPAAGSTSQPPLPGQPPLPGQPPFSGQIPTSQP----APSP 234 Query: 764 XAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPP-PPXXXXXPP- 937 PP PP P P PP PP Sbjct: 235 YGVPSSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFPPQQPGLPPL 294 Query: 938 ----XPPRPXPP 961 PP+P P Sbjct: 295 SQPGLPPQPGAP 306 Score = 34.3 bits (75), Expect = 0.25 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +2 Query: 503 PXXAPPXXGXXP--PPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXX 676 P PP G PP P P P PP P P PP P P Sbjct: 328 PGAPPPLPGQQAAAPPQFGAPQPGYPGQQPGYPPQPGQQP--MPGYPPQPGQQLGGPGYP 385 Query: 677 P-PXPPPPGPPXXPPXXPPXXP 739 P P PG P P P P Sbjct: 386 PQPGAGFPGQPGRPGFNQPPMP 407 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 532 PXPPPPRPXXPPXPXPXPXPPXPPXPXPXXXXXXXPPSP 648 P P +P PP P P P PP P PP P Sbjct: 350 PGYPGQQPGYPPQPGQQPMPGYPPQPGQQLGGPGYPPQP 388 Score = 31.9 bits (69), Expect = 1.4 Identities = 31/134 (23%), Positives = 31/134 (23%), Gaps = 2/134 (1%) Frame = +2 Query: 542 PXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPP-PA-XPXPXXXPPXPPPPGPPXXP 715 P PP P PP P P PP P P P P P P P Sbjct: 179 PHMPPPKAATPGAAPGQPPIPAAGSTSQPPLPGQPPLPGQPPFSGQIPTSQPAPSPYGVP 238 Query: 716 PXXPPXXPXPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPX 895 P P P P P P P P P Sbjct: 239 SSRPGQPQLPPGATPPTYTQPGLPPQQQQGIPPLQQPGIPQQQPGFP-PQQPGLP-PLSQ 296 Query: 896 PAXPPPPXXXXXPP 937 P PP P P Sbjct: 297 PGLPPQPGAPYGAP 310 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 42.7 bits (96), Expect = 7e-04 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXP-XPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX 712 PPP PA P P P P P P P PPPA P P P PPPP Sbjct: 288 PPPPPASPSPSRSSSLP-PPASPSPSLPPPASPSLSLPPPASPSP---SPSPPPPAEATA 343 Query: 713 PPXXP 727 P P Sbjct: 344 PAPVP 348 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +2 Query: 518 PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 P G P P P P P P P P P P+ P P PPP Sbjct: 268 PGGGAGPAPTSVIVTAGRKQPPPP-PASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPP 326 Query: 698 GPPXXPPXXPPXXPXPXXXPXPXA 769 P P PP P P A Sbjct: 327 ASPSPSPSPPPPAEATAPAPVPAA 350 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP +P P PA P P P P P P P P PPPA Sbjct: 290 PPPASPSPSRSSSLPPPASPSPSL--PPPASPSLSLPPPASPSPSPSPPPPAEATAPAPV 347 Query: 680 PXPPPP 697 P P Sbjct: 348 PAAAQP 353 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP P P + P P P PP P P P P+ P P P Sbjct: 288 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAPAPV 347 Query: 695 P 697 P Sbjct: 348 P 348 Score = 32.7 bits (71), Expect = 0.77 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P PPP +P P + PPP P P PP Sbjct: 289 PPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPP 336 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 558 PPPXPXAPXXXXXPX-PPPAPPPPXXXPPXPPPPXXP 665 PPP P +P PPPA P P PP P P Sbjct: 288 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLP 324 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 PPP P P P P P P P PA P Sbjct: 324 PPPASPSPSPSPPPPAEATAPAPVPAAAQP 353 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +1 Query: 814 PPPPPPXPXXPPP---PXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPP P P P P P P P P P P PA Sbjct: 288 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPPA 339 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP +P P P+ PPP P P P Sbjct: 316 PASPSLSLPPPASPSPSPSPPPPAEATAPAPVPAAAQP 353 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXP-XAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PS PP P P P PPPA P P PP P P Sbjct: 291 PPASPSPSRSSSLPP--PASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAP 344 >AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p protein. Length = 335 Score = 42.7 bits (96), Expect = 7e-04 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G GG GG GGGG G G G+G G G G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G G GG GGGG GG G G GG GG G G G GG G Sbjct: 17 GFLGLLGGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSGPVQVVKVIHQQGGVG 76 Query: 546 XGGG 535 G Sbjct: 77 YSSG 80 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 608 GXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GG GG G G GG G GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGG 48 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG GGG G G G GG GG G G G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGG--GGGGSGARGYGGHG 58 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = -1 Query: 875 GGGXGGXGG---GGXXGXGGGGGG 813 GGG GG GG GG G GGGGGG Sbjct: 25 GGGGGGGGGLNLGGGGGNGGGGGG 48 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGGG GGG G G GGG G G G G Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNG 43 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGG GG Sbjct: 24 GGGGGGGGGGLNLGGGGGNGG 44 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -1 Query: 875 GGGXGGX--GGGGXXGXGGGGGG 813 GGG GG GGGG G GGGG G Sbjct: 28 GGGGGGLNLGGGGGNGGGGGGSG 50 Score = 32.7 bits (71), Expect = 0.77 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P A P PP A P P P P P P P P P P P P Sbjct: 239 PAPVAAPVASYLPPQEIAAPAPVYAAPAP-APVYAAPAP-APVYSAPAPAPVYSAPAPAP 296 Query: 680 P-XPPPPGPPXXPPXXPPXXPXP 745 P P P P P P Sbjct: 297 VYSAPAPAPVYSAPAPAPAYSAP 319 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GGG G GGGG G GG G Sbjct: 23 GGGGGGGGGGGLNLG----------GGGGNGGGGGGSGARGYGGHG 58 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG G G G G GG GG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 42.7 bits (96), Expect = 7e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 GGGG GG GGG+GGG G G G G G GG GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSG---SGGGSGSGDGGGGAIGG 91 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXG 853 GG G GG GG GGG +G G G+G GG G Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIG 90 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 738 GXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G GG GG GG GGG G G G GGG G Sbjct: 56 GGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIG 90 Score = 36.7 bits (81), Expect = 0.048 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G GG GG G GG +G G G+G G G GG Sbjct: 56 GGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 664 GXXGGGGXGGXXXG-GGGAGGGXGXXXXXGAXGXGGG 557 G GGGG GG G GGG+G G G G G GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 35.9 bits (79), Expect = 0.083 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = -3 Query: 957 GXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 G G GG GG G GG +G G G+G G G G GG Sbjct: 55 GGGGGGGGG-----GSGGGSGGGSGSGGGSGSGDGGGG 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 702 GPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 G GGGG GG G G G GG G G GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 693 GGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXG 577 GGG GG G G +GGG GG G G G GG G Sbjct: 55 GGGGGG---GGGGSGGGSGGGSGSGGGSGSGDGGGGAIG 90 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G GG GG GGG GG G +G G GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGG 85 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -2 Query: 622 GGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXGXXXG 500 GGG GGG G G+ G GG G GGG G G G Sbjct: 55 GGGGGGGGG-----GSGGGSGGGSGSGGGSGSGDGGGGAIG 90 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GG GG G GG G G GGGG Sbjct: 56 GGGGGGGGGSG--------------GGSGGGSGSGGGSGSGDGGGG 87 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 744 GXGXXGGXXGGXXGGPGGGGXGGXXXGXGXAGGGXGG 634 G G GG G G GG G GG GG GG Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGG 816 GGG GG GGG G GGG G Sbjct: 55 GGGGGGGGGGSGGGSGGGSG 74 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 872 GGXGGXGGGGXXGXGGGGGG 813 GG GG GGGG G GGG G Sbjct: 55 GGGGGGGGGGSGGGSGGGSG 74 Score = 32.7 bits (71), Expect = 0.77 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 609 GXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXG 502 G G GG G G G G+G G G GGA G Sbjct: 56 GGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.3 bits (65), Expect = 4.1 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 660 GXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAGXGGGXXP 526 G GGG GG G G G GG G G GG G GG P Sbjct: 56 GGGGGGGGG-----SGGGSG-GGSGSGGGSGSGDGGGGAIGGTCP 94 >AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-PA protein. Length = 991 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -2 Query: 655 GGGGXGGXXXGGGGAGGGXGXXXXXGAXGXGGGXG 551 GG G GG GGGG GGG G G+ G GG G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 38.3 bits (85), Expect = 0.016 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 637 GXXXGGGGAGGGXGXXXXXGAXGXGGGXGGXGGG 536 G GGGG GGG G G G GGG GG GG Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYG-GGGSGGDAGG 55 Score = 38.3 bits (85), Expect = 0.016 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GGGG G Sbjct: 30 GGGGGGGGGGGLGGYGGGGSG 50 Score = 37.9 bits (84), Expect = 0.021 Identities = 18/33 (54%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 729 GGXXGGXXGGPGGGGXGG-XXXGXGXAGGGXGG 634 GG GG GG GGGG GG G G +GG GG Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGGDAGG 55 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGG 816 GAGG G GG G GGG GG GGGG G GG G Sbjct: 24 GAGGGGGGGGGGGG-----------GGGLGGYGGGGSGGDAGGSG 57 Score = 37.1 bits (82), Expect = 0.036 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GG GGG Sbjct: 27 GGGGGGGGGGGGGGLGGYGGG 47 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 945 GGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG GG GGGG G G G G GG G G GG Sbjct: 23 GGAGG-----GGGGGGGGGGGGGLGGYGGGGSGG 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 705 GGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGG 592 GG GGGG GG G G GGG GG G G G Sbjct: 23 GGAGGGGGGG---GGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GG GG GGGG G GGG GG Sbjct: 23 GGAGGGGGGGGGGGGGGGLGG 43 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 951 GRGGXGGXXXXXGGGGXAGXGXGAGXGGXXG 859 G GG GG GGGG G G G GG G Sbjct: 24 GAGGGGGGGGGGGGGGGLGGYGGGGSGGDAG 54 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAG 877 GG G GG GG GGGG G G+G Sbjct: 30 GGGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 33.1 bits (72), Expect = 0.59 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG G GG GG Sbjct: 26 GGGGGGGGGGGGGGGLGGYGG 46 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXG 847 GG G GG GG GGGG G G G G G G Sbjct: 23 GGAGGGGGGGG---GGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 29.9 bits (64), Expect = 5.5 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 962 GAGXGAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGG 846 GAG G GG G GG G GGG GG GG Sbjct: 24 GAGGGGGGGGGGGGGGGLGGYG-------GGGSGGDAGG 55 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 580 GAXGXGGGXGGXGGGXXXXXGXG 512 G G GGG GG GGG G G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYG 45 Score = 29.1 bits (62), Expect = 9.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 580 GAXGXGGGXGGXGGGXXXXXGXG 512 G G GGG GG GGG G G Sbjct: 26 GGGGGGGGGGGGGGGLGGYGGGG 48 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 42.7 bits (96), Expect = 7e-04 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXP-XPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXX 712 PPP PA P P P P P P P PPPA P P P PPPP Sbjct: 2555 PPPPPASPSPSRSSSLP-PPASPSPSLPPPASPSLSLPPPASPSP---SPSPPPPAEATA 2610 Query: 713 PPXXP 727 P P Sbjct: 2611 PAPVP 2615 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +2 Query: 518 PXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPP 697 P G P P P P P P P P P P+ P P PPP Sbjct: 2535 PGGGAGPAPTSVIVTAGRKQPPPP-PASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPP 2593 Query: 698 GPPXXPPXXPPXXPXPXXXPXPXA 769 P P PP P P A Sbjct: 2594 ASPSPSPSPPPPAEATAPAPVPAA 2617 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP +P P PA P P P P P P P P PPPA Sbjct: 2557 PPPASPSPSRSSSLPPPASPSPSL--PPPASPSLSLPPPASPSPSPSPPPPAEATAPAPV 2614 Query: 680 PXPPPP 697 P P Sbjct: 2615 PAAAQP 2620 Score = 33.9 bits (74), Expect = 0.34 Identities = 20/80 (25%), Positives = 20/80 (25%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 PP PP P P P P P P P P PPP P Sbjct: 1263 PPALQPPIFASMPVAVPVVPAPVPPPPVAAAAPLPVAAIVPLPVAAPAPPPVATALVHPP 1322 Query: 680 PXPPPPGPPXXPPXXPPXXP 739 P PP P Sbjct: 1323 TRRTPTKAAAKQMGAPPPKP 1342 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPPXPPP 694 PP P P + P P P PP P P P P+ P P P Sbjct: 2555 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAPAPV 2614 Query: 695 P 697 P Sbjct: 2615 P 2615 Score = 32.7 bits (71), Expect = 0.77 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 513 PXPSXXXXPPPXPPXPPPXPXAPXXXXXPXPPPAPPPPXXXPPXPPPP 656 P P P PPP +P P + PPP P P PP Sbjct: 2556 PPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPP 2603 Score = 32.3 bits (70), Expect = 1.0 Identities = 30/128 (23%), Positives = 30/128 (23%), Gaps = 6/128 (4%) Frame = +2 Query: 578 PXPXXPPXPXPXPXXXXXXPPX--PPPAXPXPXXXP----PXPPPPGPPXXPPXXPPXXP 739 P PP P PP PP P P P PPPP P P Sbjct: 1244 PPAVPPPAVAPAILNAAPAPPALQPPIFASMPVAVPVVPAPVPPPPVAAAAPLPVAAIVP 1303 Query: 740 XPXXXPXPXAXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPXXPPXPAPXPXPAXPPPPX 919 P P P PP P P A P P Sbjct: 1304 LPVAAPAPPPVATALVHPPTRRTPTKAAAKQMGAPPPKPPASLAALKQYPPLEATLPVPP 1363 Query: 920 XXXXPPXP 943 PP P Sbjct: 1364 TNSAPPVP 1371 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 558 PPPXPXAPXXXXXPX-PPPAPPPPXXXPPXPPPPXXP 665 PPP P +P PPPA P P PP P P Sbjct: 2555 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLP 2591 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 537 PPPXPPXPPPXPXAPXXXXXPXPPPAPPPP 626 PPP P P P P P P P PA P Sbjct: 2591 PPPASPSPSPSPPPPAEATAPAPVPAAAQP 2620 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +1 Query: 814 PPPPPPXPXXPPP---PXPPXPPPXXXXXXXXXXXXXXPXPPXPXPPAPXPA 960 PPPPP P P P P P P P P P P PA Sbjct: 2555 PPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPPA 2606 Score = 31.5 bits (68), Expect(2) = 0.005 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 845 PPXPXPXXPPXPAPXPXPAXPPPPXXXXXPPXPPRPXP 958 P P PP +P P P+ PPP P P P Sbjct: 2583 PASPSLSLPPPASPSPSPSPPPPAEATAPAPVPAAAQP 2620 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXP-XAPXXXXXPXPPPAPPPPXXXPPXPPPPXXP 665 P P PS PP P P P PPPA P P PP P P Sbjct: 2558 PPASPSPSRSSSLPP--PASPSPSLPPPASPSLSLPPPASPSPSPSPPPPAEATAP 2611 Score = 30.7 bits (66), Expect = 3.1 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 6/84 (7%) Frame = +2 Query: 536 PPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPA-----XPXPXXXPPXPPPPG 700 P PAPP P P PP PPA P P PP Sbjct: 1305 PVAAPAPPPVATALVHPPTRRTPTKAAAKQMGAPPPKPPASLAALKQYPPLEATLPVPPT 1364 Query: 701 PPXXP-PXXPPXXPXPXXXPXPXA 769 P P P P P P P A Sbjct: 1365 NSAPPVPVAVPLVPVPVPVPVPVA 1388 Score = 29.9 bits (64), Expect = 5.5 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 10/62 (16%) Frame = +3 Query: 501 PXXXPXPSXXXXPPPXPPXPPPXPXAP-XXXXXPXPPPAPPP---------PXXXPPXPP 650 P P P PP PP AP P PP PP P P PP Sbjct: 1228 PETLAEPIQERKPVAMPPAVPPPAVAPAILNAAPAPPALQPPIFASMPVAVPVVPAPVPP 1287 Query: 651 PP 656 PP Sbjct: 1288 PP 1289 Score = 27.5 bits (58), Expect(2) = 0.005 Identities = 14/52 (26%), Positives = 14/52 (26%) Frame = +2 Query: 602 PXPXPXXXXXXPPXPPPAXPXPXXXPPXPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P P PP P P P PP P P P Sbjct: 2531 PRPHPGGGAGPAPTSVIVTAGRKQPPPPPASPSPSRSSSLPPPASPSPSLPP 2582 >AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA protein. Length = 376 Score = 42.7 bits (96), Expect = 7e-04 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -3 Query: 960 GGXGRGGXGGXXXXXGGGGXAGXGXGAGXGGXXGXGXGG 844 GG G GG GG GGGG G G G+G G G G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -3 Query: 726 GXXGGXXGGPGGGGXGGXXXGXGXAGGGXGGXXXXXXGXGXGXGGXXGXGXXXXGXGGAG 547 G G GG GGGG GG G G GG GG G G G GG G Sbjct: 17 GFLGLLGGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSGPVQVVKVIHQQGGVG 76 Query: 546 XGGG 535 G Sbjct: 77 YSSG 80 Score = 36.7 bits (81), Expect = 0.048 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 608 GXGGXGGXGXGXGXGGXXGRGGGGXG 531 G GG GG G G GG G GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGG 48 Score = 36.3 bits (80), Expect = 0.063 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXGXG 512 GGGG GGG G G G GG GG G G G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGG--GGGGSGARGYGGHG 58 Score = 35.1 bits (77), Expect = 0.15 Identities = 23/88 (26%), Positives = 24/88 (27%), Gaps = 1/88 (1%) Frame = +2 Query: 503 PXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP 682 P AP P P + P P P P P P PA P P Sbjct: 265 PAPAPVYAAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPAYSAPAPAPV 324 Query: 683 -XPPPPGPPXXPPXXPPXXPXPXXXPXP 763 P P P P P P P P Sbjct: 325 YSAPAPAPVYAAPAPAPVLSVPHPAPAP 352 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = -1 Query: 875 GGGXGGXGG---GGXXGXGGGGGG 813 GGG GG GG GG G GGGGGG Sbjct: 25 GGGGGGGGGLNLGGGGGNGGGGGG 48 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 625 GGGGAGGGXGXXXXXGAXGXGGGXGGXGGGXXXXXG 518 GGGG GGG G G GGG G G G G Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGGG GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNG 43 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 875 GGGXGGXGGGGXXGXGGGGGG 813 GGG GG GGG G GGG GG Sbjct: 24 GGGGGGGGGGLNLGGGGGNGG 44 Score = 34.3 bits (75), Expect = 0.25 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +2 Query: 500 PPXXAPPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXP 679 P A P PP A P P P P P P P P P P P P Sbjct: 239 PAPVAAPVASYLPPQEIAAPAPVYAAPAP-APVYAAPAP-APVYSAPAPAPVYSAPAPAP 296 Query: 680 P-XPPPPGPPXXPPXXPPXXPXPXXXP 757 P P P P P P P Sbjct: 297 VYSAPAPAPVYSAPAPAPAYSAPAPAP 323 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -1 Query: 875 GGGXGGX--GGGGXXGXGGGGGG 813 GGG GG GGGG G GGGG G Sbjct: 28 GGGGGGLNLGGGGGNGGGGGGSG 50 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 950 GAGGXGXGGXGXXXXXXXXXXXXRXGGGXGGXGGGGXXGXGGGGGG 813 G GG G GG G GGG G GGGG G GG G Sbjct: 23 GGGGGGGGGGG----------LNLGGGGGNGGGGGGSGARGYGGHG 58 Score = 31.1 bits (67), Expect = 2.4 Identities = 21/82 (25%), Positives = 21/82 (25%), Gaps = 1/82 (1%) Frame = +2 Query: 515 PPXXGXXPPPXPAPPXPXXXXPXPXXPPXPXPXPXXXXXXPPXPPPAXPXPXXXPP-XPP 691 PP P P A P P P P P P P P P P Sbjct: 251 PPQEIAAPAPVYAAPAPAPVYAAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVYSAP 310 Query: 692 PPGPPXXPPXXPPXXPXPXXXP 757 P P P P P P Sbjct: 311 APAPAYSAPAPAPVYSAPAPAP 332 Score = 29.1 bits (62), Expect = 9.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -3 Query: 615 GXGXGXGGXXGXGXXXXGXGGAGXGGGXXPXXGGAXXGG 499 G G G GG G G G G GG GG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.311 0.155 0.587 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,737,433 Number of Sequences: 53049 Number of extensions: 2013331 Number of successful extensions: 161200 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57168 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4812612705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (22.0 bits)
- SilkBase 1999-2023 -