BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H20 (845 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07140.2 68416.m00851 GPI transamidase component Gpi16 subuni... 29 2.9 At3g07140.1 68416.m00850 GPI transamidase component Gpi16 subuni... 29 2.9 >At3g07140.2 68416.m00851 GPI transamidase component Gpi16 subunit family protein similar to phosphatidyl inositol glycan class T (GI:14456615) [Homo sapiens]; contains Pfam profile PF04113: Gpi16 subunit, GPI transamidase component Length = 643 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 4/67 (5%) Frame = -3 Query: 216 TWAREQRWSCSKPAPERRRRI----GSLRNSL*VYVNSNADVKTPSGAVLIHLMCTIXNV 49 TW R +WSC + AP R G+ R ++ + + + + SG L + CTI Sbjct: 347 TWKRPSKWSCQQ-APLHSSRFLMGSGNERGAIAILLKATESQEKLSGRDLTNGQCTI-KA 404 Query: 48 KILKEFP 28 I + FP Sbjct: 405 NIFQIFP 411 >At3g07140.1 68416.m00850 GPI transamidase component Gpi16 subunit family protein similar to phosphatidyl inositol glycan class T (GI:14456615) [Homo sapiens]; contains Pfam profile PF04113: Gpi16 subunit, GPI transamidase component Length = 644 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 4/67 (5%) Frame = -3 Query: 216 TWAREQRWSCSKPAPERRRRI----GSLRNSL*VYVNSNADVKTPSGAVLIHLMCTIXNV 49 TW R +WSC + AP R G+ R ++ + + + + SG L + CTI Sbjct: 347 TWKRPSKWSCQQ-APLHSSRFLMGSGNERGAIAILLKATESQEKLSGRDLTNGQCTI-KA 404 Query: 48 KILKEFP 28 I + FP Sbjct: 405 NIFQIFP 411 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,442,311 Number of Sequences: 28952 Number of extensions: 250196 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -