BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H16 (1157 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 31 2.3 10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 29 7.0 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 30.7 bits (66), Expect = 2.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 970 PPKXXXPXFXRGGXGGXFXXXXKTXPXPPPXXP 872 PP P F RGG G + K PPP P Sbjct: 11 PPPPPPPPFGRGGGGAGYPRGHKQLYAPPPPPP 43 >10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 Length = 532 Score = 29.1 bits (62), Expect = 7.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 185 KRXXVIRTGEGQGPSRIAKGSSFKRPGSFKTV 280 KR + G + P+R+ KG ++K G KTV Sbjct: 101 KRQFTTKAGNKRRPTRVTKGGTWKASGGSKTV 132 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,377,781 Number of Sequences: 37544 Number of extensions: 330905 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3526513192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -