BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H15 (896 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 27 3.6 SPAC19G12.08 |||fatty acid hydroxylase |Schizosaccharomyces pomb... 27 3.6 SPAC13G7.11 |||mitochondrial inner membrane protein|Schizosaccha... 26 8.4 SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccha... 26 8.4 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 307 EEIIANAFV-HHRTRHLETQVHGRAGHKP 224 EE++ F H R L T+ H R+ H+P Sbjct: 482 EEVLREVFAPKHARRRLGTRFHSRSSHRP 510 >SPAC19G12.08 |||fatty acid hydroxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 347 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 535 DFLVACASMADAMRHYSXQHIADLLS 612 ++LVA AD +R Y Q +AD+L+ Sbjct: 22 NYLVANKDAADLLRRYHRQEVADILN 47 >SPAC13G7.11 |||mitochondrial inner membrane protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 269 Score = 25.8 bits (54), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = +2 Query: 392 QIRIFWRYLY--WWTMR 436 +IR +WRYL+ WW ++ Sbjct: 73 KIRFWWRYLFYGWWNLK 89 >SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 341 Score = 25.8 bits (54), Expect = 8.4 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +2 Query: 737 KIDLLSMIVISEVAXSRVAXLDSWPVCVSTDDANAILLHAIXGKIIKN*NAHR 895 K+DL S+ S + L + V D+ ++L GKI+ AH+ Sbjct: 187 KLDLTSLFSFSSKSQLNALCLYQSKLIVGRDNGTVLVLDTSDGKILHEFTAHK 239 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,400,195 Number of Sequences: 5004 Number of extensions: 65768 Number of successful extensions: 167 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -