BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H13 (902 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1008 - 7987936-7988628,7988923-7989102 33 0.31 08_02_1006 - 23484861-23485409,23486327-23486488,23486584-23487165 30 2.9 03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 29 6.7 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 8.8 >01_01_1008 - 7987936-7988628,7988923-7989102 Length = 290 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 727 RKRHASRREKGGQVSGKRQGRKQESARGSFQGETPG 620 R R RR GG+V+G+ R + RG+++GE G Sbjct: 239 RVRRRGRRGGGGEVNGEEAARSRRRRRGAWEGEEEG 274 >08_02_1006 - 23484861-23485409,23486327-23486488,23486584-23487165 Length = 430 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 639 SRGKRLVSL*SCRVSPPLT*ASIFVMLVQGGGAYGKTPAT 520 SRGK L+S + R PP + + V+ + GGG G P T Sbjct: 25 SRGKSLLSPSTPRSPPPSYGSIVTVLSIDGGGVRGIIPGT 64 >03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 Length = 356 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 PLPRSLTRCARSF--GCGERYQLTQRR*YGYPQNQGITQ--ERTCEQKASKRPGTV 510 P PRS RC GCG R Q TQR P N IT E TC ++ P + Sbjct: 150 PYPRSYYRCTHKLDQGCGARRQ-TQRC-EADPSNYDITYYGEHTCRDPSTIIPTAI 203 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 304 NESAN---ARGEAVCVLGALPLPRSLTRCAR 387 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,522,827 Number of Sequences: 37544 Number of extensions: 347119 Number of successful extensions: 1086 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -