BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H09 (1059 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 22 8.0 X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor pro... 22 8.0 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 8.0 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = +3 Query: 576 FGSXXLPPTXQXRTLXXXPXVPTNPSNXSXXXTPXPRP 689 FG+ L P + L P N P PRP Sbjct: 17 FGNTNLDPPTRPTRLRREAKPEAEPGNNRPVYIPQPRP 54 >X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor protein. Length = 144 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = +3 Query: 576 FGSXXLPPTXQXRTLXXXPXVPTNPSNXSXXXTPXPRP 689 FG+ L P + L P N P PRP Sbjct: 18 FGNTNLDPPTRPTRLRREAEPEAEPGNNRPVYIPQPRP 55 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = +3 Query: 576 FGSXXLPPTXQXRTLXXXPXVPTNPSNXSXXXTPXPRP 689 FG+ L P + L P N P PRP Sbjct: 18 FGNTNLDPPTRPARLRREAKPEAEPGNNRPIYIPQPRP 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,976 Number of Sequences: 438 Number of extensions: 2067 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 59 effective length of database: 120,501 effective search space used: 35306793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -