BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H06 (891 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 32 0.13 SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po... 31 0.22 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 28 2.1 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 27 3.6 SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.3 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 6.3 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 31.9 bits (69), Expect = 0.13 Identities = 13/59 (22%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +1 Query: 286 SIIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNFR--THHGRKLCQDHLQK 456 +II V+N I+D+ + ++C ++W G + +R ++ ++ +H K H+++ Sbjct: 247 AIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFYSNLYKKLSHRDAKSIYHHVRR 305 >SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 31.1 bits (67), Expect = 0.22 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 602 HNTKYNQYLKMSTTTCNCNSRXRVVYGGNSADSTRE 709 +++ YN+ M T++C+C+S + YGGN A E Sbjct: 47 YSSTYNEITNMDTSSCSCSSTPK-SYGGNLAPFDEE 81 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 602 HNTKYNQYLKMSTTTCNCNSRXRVVYGGNSA 694 HN +N + + S T+ + SR V+ GNS+ Sbjct: 617 HNEMFNSFHRSSVTSASIKSREAVLSAGNSS 647 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 27.1 bits (57), Expect = 3.6 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = -1 Query: 402 WEVLSNNFLS--VADPQL---VAVLHGVPSLVNDQVVNYILD 292 W+VL +++L+ ++ P V LHGV + VN V +YI D Sbjct: 188 WDVLFHDYLNETLSQPAFSFNVPDLHGVDNKVNQYVFDYIKD 229 >SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 662 RXRVVYGGNSADSTREQWFFQPAKYENDVLFFIYN 766 R R+V G ++A + + W F +Y ++F+++N Sbjct: 162 RQRIVVGKHAAHFSLDHWIF-VVEYYAPIVFYVFN 195 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 289 IIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVR 390 +++++ NL I N +EY LW NG I + Sbjct: 447 VLKDIFFNLQIGVTFNILEYLRHLWSNNGDAIAK 480 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,070,302 Number of Sequences: 5004 Number of extensions: 58249 Number of successful extensions: 152 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -