BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H06 (891 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1263 - 32207636-32207938,32208020-32208170,32208263-322085... 29 5.0 01_06_1729 + 39486553-39487413,39487953-39488020,39489574-394901... 29 6.6 >04_04_1263 - 32207636-32207938,32208020-32208170,32208263-32208500, 32208604-32208814,32208927-32209108,32209196-32209297, 32210002-32211187,32212103-32212499,32212551-32212582, 32212885-32213157,32213307-32213394,32213486-32213723, 32213824-32214034,32214119-32214300,32214378-32214479, 32214801-32216224,32216751-32216822,32217688-32217719, 32218186-32218263,32218425-32218512,32218608-32218845, 32219060-32219162,32219386-32219558,32219644-32219745, 32219825-32220606,32220659-32221012,32224055-32224140, 32224250-32224400,32224534-32224771,32224876-32225119, 32225190-32225368,32225577-32225675,32225835-32227083 Length = 3195 Score = 29.1 bits (62), Expect = 5.0 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 9/79 (11%) Frame = +1 Query: 256 SLEYESQGKGSIIQNVVNNLIIDKRRNTME------YCYKLWV-GNGQEIVRKYFPLNFR 414 S++ ++ G ++ +V+ L I + T Y ++LW GN E++ K+F ++ Sbjct: 684 SVKSDTYSFGVLLLEIVSGLKISSSKLTPNFFSLTAYAWRLWKDGNATELLDKFFVDSYP 743 Query: 415 THHGRKLCQ--DHLQKLQP 465 H CQ D L +P Sbjct: 744 LHEAFSFCQSDDRLTPAKP 762 >01_06_1729 + 39486553-39487413,39487953-39488020,39489574-39490154, 39490623-39491432,39491738-39493035 Length = 1205 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 212 QQHPHRRLRTVLSVRAWNMRAKARAP 289 QQ P R L AWNMR AR+P Sbjct: 188 QQQPTARAAAHLGETAWNMRGVARSP 213 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,992,848 Number of Sequences: 37544 Number of extensions: 405966 Number of successful extensions: 953 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -