BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H06 (891 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33227| Best HMM Match : DEP (HMM E-Value=0.042) 29 5.1 SB_2410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_33227| Best HMM Match : DEP (HMM E-Value=0.042) Length = 765 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 722 QPAKYENDVLFFIYNRQFNDALELGTNRERLGRPQGRWTRWXKXA 856 QPA + + +YN +N+ + TN ++ G +G+ W K A Sbjct: 481 QPASMKTSLSATVYNYSYNELRDSLTNSDKTGGRKGQDIIWQKAA 525 >SB_2410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 9/58 (15%) Frame = +2 Query: 734 YENDVLFFIYNRQFNDALELGT---------NRERLGRPQGRWTRWXKXAGLPEIXSW 880 ++N VL + N F + +GT +E G +GRW K AG+ E +W Sbjct: 153 HKNAVLQQVQNSPFELRVTMGTPPAGYTRYCTQEESGTSRGRWVECGKLAGIEECDAW 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,715,098 Number of Sequences: 59808 Number of extensions: 458219 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -