BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H04 (896 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P04148 Cluster: Fibrohexamerin precursor; n=2; Bombyx|R... 38 0.46 UniRef50_Q22G12 Cluster: Ser/Thr protein phosphatase family prot... 34 4.3 UniRef50_A0CJY8 Cluster: Chromosome undetermined scaffold_2, who... 33 7.5 UniRef50_Q6NJ90 Cluster: Putative membrane protein; n=1; Coryneb... 33 9.9 >UniRef50_P04148 Cluster: Fibrohexamerin precursor; n=2; Bombyx|Rep: Fibrohexamerin precursor - Bombyx mori (Silk moth) Length = 220 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 292 EVDIPNSNLTVEYHDVKTRGFDTIKIIEFYINSKTEKLVLAAEVQSLKLASPKTI 456 + +IP N T H++ TR D ++ EFY N +T K VL + L S +T+ Sbjct: 62 QFEIPYFNATYVDHNLITRNHDQCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTL 116 >UniRef50_Q22G12 Cluster: Ser/Thr protein phosphatase family protein; n=1; Tetrahymena thermophila SB210|Rep: Ser/Thr protein phosphatase family protein - Tetrahymena thermophila SB210 Length = 884 Score = 34.3 bits (75), Expect = 4.3 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 4/109 (3%) Frame = +3 Query: 405 SISSRSAVLKIGFAENNFQYNRKAKEPIVRSDALEVDYGTLTFTAVFPSISDLQLSNAEV 584 SI++ VLK F + + AK+PI+R + ++ F + +SDL + EV Sbjct: 355 SINNFKIVLKENFPNSPHLF---AKKPILRFKIEQSNFDVFNFQRIESKLSDLVANPGEV 411 Query: 585 FSYVHE--INPKFILGPLL--SFSLDSETQSQLGKLLNNIAVSLQEVFE 719 + INPK I P L F + +S + N ++E++E Sbjct: 412 LKFWKRIIINPKTIKNPKLEEDFIKTLKGKSDFDTIGNETVKDIKELYE 460 >UniRef50_A0CJY8 Cluster: Chromosome undetermined scaffold_2, whole genome shotgun sequence; n=4; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_2, whole genome shotgun sequence - Paramecium tetraurelia Length = 719 Score = 33.5 bits (73), Expect = 7.5 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +1 Query: 340 KTRGFDTIKIIEFYINSKTEKLVLAAEVQSLKLASPKTI--FNTIGKPKSQL*EVT 501 K R IKIIE + SK+EKL+LA EV+ +KL + I F+ I + K+ L +T Sbjct: 457 KDRQTLAIKIIEKFKLSKSEKLMLAHEVEIMKLLNHSCIVRFHEIIETKTHLNIIT 512 >UniRef50_Q6NJ90 Cluster: Putative membrane protein; n=1; Corynebacterium diphtheriae|Rep: Putative membrane protein - Corynebacterium diphtheriae Length = 678 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 337 VKTRGFDTIKIIEFYINSKTEKLVLAAEVQSLKLASPKTIFNTIG 471 VK +D+ + +Y++SK +K ++ EV S L PK I G Sbjct: 281 VKVGAYDSAAHMYYYVDSKNKKDLMGIEVSSTSLGQPKKIATATG 325 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,260,665 Number of Sequences: 1657284 Number of extensions: 11667788 Number of successful extensions: 23818 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23818 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81161904978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -