BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H04 (896 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 27 0.26 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 27 0.26 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 4.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 7.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 7.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 26.6 bits (56), Expect = 0.26 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 183 GAFDVFWVHRPDPSALQKQQQKRXNPKLK 97 G +V V +PDP+A+QK ++K+ K K Sbjct: 1033 GTREVTVVPKPDPNAVQKIEEKKPEKKDK 1061 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 26.6 bits (56), Expect = 0.26 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 183 GAFDVFWVHRPDPSALQKQQQKRXNPKLK 97 G +V V +PDP+A+QK ++K+ K K Sbjct: 1033 GTREVTVVPKPDPNAVQKIEEKKPEKKDK 1061 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 506 QCVTSYNWLFGFPIVLKI 453 +CV +N LFGF ++L + Sbjct: 203 ECVDLFNSLFGFLVLLLV 220 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 488 NWLFGFPIVL--KIVFGEANFKDCTSAANTSFS 396 N LFGFPI++ I F F C N+ + Sbjct: 250 NMLFGFPIIIGCLIQFNTIVFSFCYCYYNSKMT 282 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/43 (18%), Positives = 20/43 (46%) Frame = -3 Query: 408 Y*FFSFAVNVKLNDFNSIEASGFNIMIFYG*ITIRYIYFCSNL 280 Y F + +++ FN+ ++ + +F+ + + Y S L Sbjct: 502 YLMFDYCTVLRVQRFNNYQSLAHYLRVFFTVFNVVHCYLASEL 544 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,391 Number of Sequences: 336 Number of extensions: 3074 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -