BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H04 (896 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |S... 28 2.1 SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ... 27 3.6 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 27 3.6 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 27 4.8 SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ... 26 8.4 >SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 1052 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 579 EVFSYVHEINPKFILGPLLSFSLDSETQSQLGKLLNNIAVSLQEVFE 719 + + ++H IN F+L LLS SL + SQ KLL +++ +++ E Sbjct: 878 KTYGHLHYIN--FVLEKLLSSSLLTYNSSQRDKLLYEVSLLFKDLQE 922 >SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase Cho2|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 528 LEFHSQLPMRHFLQLALWLSYC 463 LEF+S L RHF+ L L +C Sbjct: 199 LEFNSWLVFRHFVDLILMCDFC 220 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 27.1 bits (57), Expect = 3.6 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +3 Query: 540 VFPSISDLQLSNAEVFSYVHEINPKFILGPLLSFSLDSETQSQLGKLLNNIAVSLQEVFE 719 +F I+DLQ+ NAE+ V+E + SL +E + +L L + + L++ E Sbjct: 718 LFREINDLQIQNAEMKEQVYEKESTISQKEVEITSLRNE-KDRLSTRLQQVLLELEKQHE 776 Query: 720 AQE 728 E Sbjct: 777 TNE 779 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 26.6 bits (56), Expect = 4.8 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = -1 Query: 317 KLLFGISTSVVT*R*WILVQVPLLIDIENFLRNIHECSSSRSSXQGLLMFFGXIGRIQVR 138 K LF ST++V + W LV P ++ + N + I + +LMFF + R V Sbjct: 176 KSLFKFSTNLVKFQ-WFLVPEPQMLQLVNSVVQICNHARLEDVVTEVLMFFDSMIRYSVI 234 Query: 137 SKSN 126 K++ Sbjct: 235 PKAS 238 >SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.8 bits (54), Expect = 8.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 570 SNAEVFSYVHEINPKFILGPLLSFSLDS 653 +N + S V +NP ++ PLL SLD+ Sbjct: 44 TNRIMLSVVSSLNPDSLIAPLLCVSLDN 71 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,924,241 Number of Sequences: 5004 Number of extensions: 53216 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -