BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_H03 (939 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_54784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_16220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = +1 Query: 718 GXXGEGGXGFFXXXKTPPTPXXKXXFXXXGPXPXFPXQXXPXPPXXXXGXXXXXPPXGGX 897 G G G F P + P P +P PP G PP GG Sbjct: 552 GIDGAQVRGKFSPYGQTYVPDHRTTGGYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGH 611 Query: 898 XXFPXXXGXP 927 P G P Sbjct: 612 PHHPPPTGYP 621 >SB_54784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 228 PEVHDFVDHVGPCDVPQCFCDRP 296 PE+ D D GPC VP F D P Sbjct: 10 PEIQDNPDGWGPCSVPTAFKDIP 32 >SB_16220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 108 LFVVAAVGYVTGQHFPTRKCPKGEH 182 LF +A + ++TG H TRK P GEH Sbjct: 354 LFAMATLYFLTGYHLWTRK-PPGEH 377 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,876,570 Number of Sequences: 59808 Number of extensions: 375704 Number of successful extensions: 912 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2740956230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -