BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G24 (911 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) 68 1e-11 SB_12835| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 >SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) Length = 61 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +1 Query: 313 KVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFV 441 KVHGSLARAGKVK QTPKV+ TGRAKRR+QYNRRFV Sbjct: 2 KVHGSLARAGKVKSQTPKVDAQEKKKKKTGRAKRRMQYNRRFV 44 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 443 NVVQTFGRRRGPNSNS 490 NVVQTFGRRRGPNSN+ Sbjct: 45 NVVQTFGRRRGPNSNA 60 >SB_12835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -1 Query: 149 PLTSRTCVDCPLICNCIXVKXLSNPSLTSQNSLXGSS 39 P +RTC DC I + V+ +P LTS NS GS+ Sbjct: 246 PADARTCRDCSAITLNLPVQLALSP-LTSMNSTTGSA 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,569,530 Number of Sequences: 59808 Number of extensions: 310301 Number of successful extensions: 653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2633701421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -