BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G23 (907 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr ... 33 0.042 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 32 0.13 SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.7 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 27 3.7 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 3.7 SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb... 27 4.8 SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 26 6.4 SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||... 26 6.4 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 6.4 >SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 255 Score = 33.5 bits (73), Expect = 0.042 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +2 Query: 113 MLAASAGVV--ELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSII 268 ++ A+AG+ LS + N+D+ K+ L G Y +A ++ QGKGS+I Sbjct: 91 VMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGSLI 144 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 31.9 bits (69), Expect = 0.13 Identities = 13/59 (22%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +2 Query: 260 SIIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNFR--THHGRKLCQDHLQK 430 +II V+N I+D+ + ++C ++W G + +R ++ ++ +H K H+++ Sbjct: 247 AIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFYSNLYKKLSHRDAKSIYHHVRR 305 >SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 238 FQALTDSTVVVAGEDAVVQFLLEVLV 161 F +T V+V EDAVV+F+L +LV Sbjct: 181 FLGVTVQYVMVLPEDAVVEFVLTILV 206 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 27.1 bits (57), Expect = 3.7 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = -1 Query: 376 WEVLSNNFLS--VADPQL---VAVLHGVPSLVNDQVVNYILD 266 W+VL +++L+ ++ P V LHGV + VN V +YI D Sbjct: 188 WDVLFHDYLNETLSQPAFSFNVPDLHGVDNKVNQYVFDYIKD 229 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 161 NQDLEEKLYNSILTGDYDSAVRQSLE 238 + DLE+ + ++LTGD SAV+ LE Sbjct: 551 DSDLEKNITEALLTGDVLSAVKACLE 576 >SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 26.6 bits (56), Expect = 4.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 638 RXRVVYGGNSADSTREQWFFQPAQYENDVLFFIYN 742 R R+V G ++A + + W F +Y ++F+++N Sbjct: 162 RQRIVVGKHAAHFSLDHWIF-VVEYYAPIVFYVFN 195 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 126 ARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAW 236 AR SLNY ++ + SRRN ++P S + W Sbjct: 622 ARESLNYLKSFNKQLSRRNAPDINNPIADFQNSFQNW 658 >SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1158 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -2 Query: 177 SSRSWLEVSADSSTTPALAASMHIANTTRSFVLLGALSDRPSS 49 +S S+ V +DSSTTP +++S+ + + L A++ P + Sbjct: 318 TSDSFDSVLSDSSTTPTISSSVQVNSLAFITSSLSAITKEPEA 360 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.2 bits (55), Expect = 6.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 263 IIQNVVNNLIIDKRRNTMEYCYKLWVGNGQEIVR 364 +++++ NL I N +EY LW NG I + Sbjct: 447 VLKDIFFNLQIGVTFNILEYLRHLWSNNGDAIAK 480 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,076,873 Number of Sequences: 5004 Number of extensions: 55951 Number of successful extensions: 176 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -