BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G22 (1034 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 86 5e-17 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 56 4e-08 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 37 0.023 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 36 0.071 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_49749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) 31 2.0 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_26755| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 4.6 SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 29 6.1 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) 29 6.1 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.1 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 85.8 bits (203), Expect = 5e-17 Identities = 51/90 (56%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +2 Query: 701 KSXXQVRGGETRQDYKXTRRFPLESSLXALSXFRXLXXLPDTCXAFLPSGKRGAFSXLXL 880 K QVRGGETRQDYK TRRFPLE+ AL FR LPDTC P R A+ L Sbjct: 126 KIDAQVRGGETRQDYKDTRRFPLEAPSCAL-LFRP-CRLPDTCP---PFSLREAWRFLIA 180 Query: 881 *VSXF--RCRSXAPSWAVCTNPPFXPXXXP 964 RCRS APSWAVCTNPPF P P Sbjct: 181 HAVGISVRCRSFAPSWAVCTNPPFSPTAAP 210 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 56.4 bits (130), Expect = 4e-08 Identities = 43/93 (46%), Positives = 51/93 (54%) Frame = +2 Query: 560 KSXGITQEKNHVEPKRASQKARKPVKKAXFAGRFFHRAPPPLNEPSQKSXXQVRGGETRQ 739 K+ GITQE+ + +AS+ R K RF + P + K QVRGGETRQ Sbjct: 114 KNQGITQERTCEQ--KASK--RPGTVKRPRCWRFSIGSAPLTS--ITKIDAQVRGGETRQ 167 Query: 740 DYKXTRRFPLESSLXALSXFRXLXXLPDTCXAF 838 DYK TRRFPLE+ AL FR LPDTC F Sbjct: 168 DYKDTRRFPLEAPSCAL-LFRP-CRLPDTCPPF 198 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = +2 Query: 659 FFHRAPPPLNEPSQKSXXQVRGGETRQDYKXTRRFPLESSLXAL 790 FFHR P + KS Q+ GGETRQDYK TRRFPL + AL Sbjct: 113 FFHRLRPLTS--ITKSDAQISGGETRQDYKDTRRFPLAAPSCAL 154 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/42 (52%), Positives = 24/42 (57%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 VVR KLGCVH PPV P R AL +P + LSP A A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESKPVRHDLSPLAAA 42 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 VVR KLGCVH PPV P R AL P + LSP A A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAA 42 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 VVR KLGCVH PPV P R AL P + LSP A A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAA 42 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 VVR KLGCVH PPV P R AL P + LSP A A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAA 42 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 23/42 (54%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 VVR KLGCVH PPV P R AL P + LSP A A Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHDLSPLAAA 42 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 769 QGETPGXFIVLSGFATSDLXXRF 701 QGET G FIVLSGFAT+DL RF Sbjct: 19 QGETLGIFIVLSGFATTDLSVRF 41 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 45 VVRSKLGCVHEPPVQPDRCAL 65 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 34 VVRSKLGCVHEPPVQPDRCAL 54 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +1 Query: 904 VVRPKLGCVHXPPVXPXRXAL 966 VVR KLGCVH PPV P R AL Sbjct: 1 VVRSKLGCVHEPPVQPDRCAL 21 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +2 Query: 701 KSXXQVRGGETRQDYKXTRR 760 KS Q+ GGETRQDYK TRR Sbjct: 163 KSDAQISGGETRQDYKDTRR 182 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 35.5 bits (78), Expect = 0.071 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +1 Query: 919 LGCVHXPPVXPXRXALIPVLSS*VQPGKXXLSPXAXA 1029 LGCVH PPV P R AL PG+ LSP A Sbjct: 58 LGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTA 94 >SB_49749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 17 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 869 MRKXHAFPXGERRXRYP 819 MRK HAFP GE+ RYP Sbjct: 1 MRKRHAFPKGEKPDRYP 17 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = -1 Query: 770 PGGNAWYXYSPVGFRHL*LEXSIFVMARSGGAEPYGKNAQQTRPFLXVSWPFGWP 606 PG NAWY +SPVGF E + SGG + + P S P+ P Sbjct: 5 PGCNAWYRHSPVGFGPHGFERQL-SSCLSGGWSLWKNGFPASPPHFRASSPWRLP 58 >SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) Length = 265 Score = 30.7 bits (66), Expect = 2.0 Identities = 23/71 (32%), Positives = 30/71 (42%) Frame = -1 Query: 536 RPLEXRLNNPASPGKPETXPRRQAEFXVEXGRKSRERGGPQITPKTRPFSPRRRFGPEFS 357 R E RL+ +SP + PRRQ + RK + R + P PR R F Sbjct: 158 RQRERRLHKHSSPSISPSPPRRQKYSNGQSDRKGKHRH----RDSSSPSPPRHRSRSPFR 213 Query: 356 I*NAKKKKPFP 324 N K+K FP Sbjct: 214 --NGNKRKGFP 222 >SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 27 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 919 LGCVHXPPVXPXRXAL 966 LGCVH PPV P R AL Sbjct: 2 LGCVHEPPVQPDRCAL 17 >SB_26755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1607 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -2 Query: 775 AFQGETPGXFIVLSGFATSDLXXRFL*WLVQGGRSPMEKTPSKXGLF 635 AFQ T ++ +SGF S R L W + G + T +K GLF Sbjct: 25 AFQHSTSALYVSISGFTVSCGVMR-LKWYLLDGAAACSTTAAKSGLF 70 >SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) Length = 541 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = -1 Query: 542 ITRPLEXRLNNPASPGKPETXPRRQAEFXVEXGRKSRERGGPQITPKTRP 393 +TRP P + +P+T P+ + + + K+R + P+ PKTRP Sbjct: 239 VTRPKTRPKTRPKT--RPKTRPKTRPKTRPKTRPKTRPKTRPKTRPKTRP 286 >SB_37063| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 502 RPASPKRTRGGRRSSXWKXEGKAGKE 425 RP PKR GRR + W +A KE Sbjct: 302 RPKHPKRVEAGRRLAKWNRINRAKKE 327 >SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 882 YSXXYEKAPRFPXGRK 835 YS YEKAPRFP G + Sbjct: 14 YSVSYEKAPRFPKGER 29 >SB_22647| Best HMM Match : Ribosomal_60s (HMM E-Value=0.43) Length = 462 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 502 RPASPKRTRGGRRSSXWKXEGKAGKE 425 RP PKR GRR + W +A KE Sbjct: 302 RPKHPKRVEAGRRLAKWNRINRAKKE 327 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 502 RPASPKRTRGGRRSSXWKXEGKAGKE 425 RP PKR GRR + W +A KE Sbjct: 51 RPKHPKRVEAGRRLAKWNRINRAKKE 76 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 502 RPASPKRTRGGRRSSXWKXEGKAGKEA 422 RP P R GRR + W +A KEA Sbjct: 774 RPKHPGRVEAGRRLAKWNRINRANKEA 800 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,252,205 Number of Sequences: 59808 Number of extensions: 520472 Number of successful extensions: 1664 Number of sequences better than 10.0: 216 Number of HSP's better than 10.0 without gapping: 1370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1655 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3094779573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -