BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G22 (1034 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical pr... 31 1.8 AL032651-1|CAB60580.1| 681|Caenorhabditis elegans Hypothetical ... 29 5.4 AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical... 28 9.5 >Z81518-1|CAB04214.3| 601|Caenorhabditis elegans Hypothetical protein F28D9.1 protein. Length = 601 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/68 (32%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = -1 Query: 503 SPGKPETXPRRQAEFXVEXGRKSRERGGPQITPKTRPF-----SPRRRFGPEFSI*NAKK 339 SP K PRR+ R R R P P+ R SPRRR P S ++ Sbjct: 456 SPSKSPQAPRRRRSPSGSKSRSPRRRRSPAAAPRRRQSPQRRRSPRRRRSPSSSS-RSRS 514 Query: 338 KKPFPHQP 315 P P +P Sbjct: 515 PPPPPRRP 522 >AL032651-1|CAB60580.1| 681|Caenorhabditis elegans Hypothetical protein Y6D1A.1 protein. Length = 681 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 557 QKSXGITQEKNHVEPKRASQKARKPV--KKAXFAGRF-FHRAPPPLNEPSQKSXXQVRGG 727 Q+S Q+ H R S+ AR V + + R F R+P P P + S RGG Sbjct: 151 QRSITSRQQNYHDHSGRGSRGARSSVGTSRQQYGRRMSFDRSPSPSRAPGRGSRISDRGG 210 Query: 728 ETR 736 + R Sbjct: 211 DYR 213 >AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical protein Y22D7AR.1 protein. Length = 350 Score = 28.3 bits (60), Expect = 9.5 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = -1 Query: 512 NPASPGKPETXPRRQAEFXVEXGRKSRERGGPQITPKTRPFSPRRRFGPEFSI*NAKKKK 333 NP KP+ P+ + E + KS + P++ PK +P +P+ P + K K Sbjct: 236 NPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKP-NPKPEPNPMPELKPKPKHK 294 Query: 332 PFPHQPSP 309 P +P P Sbjct: 295 P-NSRPKP 301 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,174,218 Number of Sequences: 27780 Number of extensions: 401783 Number of successful extensions: 832 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2741106356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -