BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G21 (903 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 5.5 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 23 9.6 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 5.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -2 Query: 182 VRMVSHEIRYHISAQFVLRCESMGVIIFTFSTILELGI 69 +R+ +++H FV R + + +FTF IL L + Sbjct: 894 LRLFLMPVKHHPQVLFVRRVRTWKMHLFTFIQILALAV 931 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 208 PSTFTTVTS*HCISSYMRALDYQHP 282 PS + + H IS M+ YQHP Sbjct: 315 PSRWIACDTLHAISKVMKECWYQHP 339 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,615 Number of Sequences: 2352 Number of extensions: 11466 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -