BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G21 (903 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 27 0.18 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 25 0.94 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.7 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 27.5 bits (58), Expect = 0.18 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 170 SHEIRYHISAQFVLRCESMGVIIFTFSTI-LELGITSKKQKFKFLRXS 30 +HEI Y + ++ + VII+T+++I LE+ SKK + +R S Sbjct: 199 THEITYSLFGMIMMYWFPLVVIIYTYTSILLEIRRRSKKSEDDKIRRS 246 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 25.0 bits (52), Expect = 0.94 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 522 PNMIRYFDEFGTNPQ 566 PN++RYF TNP+ Sbjct: 830 PNLLRYFASIATNPK 844 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 199 SPGIPPLEWFLTKFVTTFLPNL 134 +PGIPP FL+ TT + L Sbjct: 1498 APGIPPAATFLSPNSTTLVLRL 1519 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 199 SPGIPPLEWFLTKFVTTFLPNL 134 +PGIPP FL+ TT + L Sbjct: 1494 APGIPPAATFLSPNSTTLVLRL 1515 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,876 Number of Sequences: 438 Number of extensions: 2926 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -