BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G18 (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 40 0.002 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 39 0.004 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 39 0.005 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.007 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 38 0.007 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 38 0.009 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 38 0.012 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 37 0.021 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.028 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 36 0.028 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 35 0.064 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.064 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.084 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 34 0.11 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.11 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.26 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.26 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.26 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 32 0.45 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 32 0.60 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.60 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 32 0.60 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.60 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 32 0.60 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 32 0.60 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.60 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 31 0.79 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 0.79 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 0.79 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.0 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 31 1.4 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 30 1.8 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 1.8 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 1.8 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 30 1.8 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 30 1.8 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 1.8 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 2.4 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 2.4 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 2.4 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 30 2.4 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 2.4 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 3.2 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 29 3.2 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 29 3.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 3.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 29 4.2 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 29 5.5 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 5.5 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 28 7.3 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 28 7.3 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 7.3 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 28 7.3 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.8 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 28 9.7 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 28 9.7 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 28 9.7 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.7 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 28 9.7 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 28 9.7 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGGG G + GGGGGG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG G GG GGGGG G + G GGGG GGG G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GG G G + GGGGGG GGG G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGG G G + GGGGG GGG G Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 35.9 bits (79), Expect = 0.037 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGGG G GGGGGG GGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGG---------GGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 35.1 bits (77), Expect = 0.064 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GGGGG G GGGGG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 32.7 bits (71), Expect = 0.34 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGGG G GGGGGG Sbjct: 851 GGGGGGGGGGGGGGGGGGG----------GGGGGGG 876 Score = 32.3 bits (70), Expect = 0.45 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGG GGGG G GGGG G GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG G G GGGGG G + G G GG GGG G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXK 616 GG GGGG GGGGG G K Sbjct: 858 GGGGGGGGGGGGGGGGGGGVIK 879 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -3 Query: 681 GGXGGG---GXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGG G GGGGG G + GG G G GGG G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP K PPPPPP PP P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP PPPPPP PP P Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 34.7 bits (76), Expect = 0.084 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PPPP PPPPPP PP P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 PPPPPP PPPPPP P Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPP PPPPP PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PP PPP PPPPP PP P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 638 PPPPXXXXPPPPXPPXXXFXXXXXXKKKXXXXPP 739 PPPP PP P PP K PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP F + PPPPP PP P Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPP 316 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP PP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PPPPPP PPPPPP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP P PPPP + PPPPPP PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.5 bits (78), Expect = 0.048 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PPP PP + PPPPPP PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 35.5 bits (78), Expect = 0.048 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PP PPP + PPPPPP PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.1 bits (77), Expect = 0.064 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 P PP PPPPPP A PPPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 408 PPPPPPPPPPPAPPPPPPP 426 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 409 PPPPPPPPPPAPPPPPPPP 427 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 410 PPPPPPPPPAPPPPPPPPP 428 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 411 PPPPPPPPAPPPPPPPPPP 429 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 P PP PPPPPP PPPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPP 682 + P PPPPP PPP PP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPP 383 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPP 423 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPP 424 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPP PP Sbjct: 407 PPPPPPPPPPPPAPPPPPP 425 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 412 PPPPPPPAPPPPPPPPPPP 430 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP PP Sbjct: 413 PPPPPPAPPPPPPPPPPPP 431 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PP PP PPPP PP Sbjct: 414 PPPPPAPPPPPPPPPPPPP 432 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = +3 Query: 513 KKI*XPLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 KK+ P PP + PPPPPP PPPPPP P P Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 35.1 bits (77), Expect = 0.064 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P+PP PPPPP + PPPPPP PP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP--PPPPPPGCAGLPPPPPP 759 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 531 LPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 LPP PPPPPP A PPPPPP P Sbjct: 725 LPPPPPSPQPGCAGLPPPPPPPPP-----GCAGLPPPPPPIDVPMKP 766 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPP---PXXXXXPPXXXP 683 P PP + PPPPPP A PPPPP P PP P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPP-----GCAGLPPPPPSPQPGCAGLPPPPPP 745 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGGG G F GGGGGG F GGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGG---FGGGGGGGG--------GFGGGGGG 125 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQP 559 G GGGG GGGGG G F GGGG G +P Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 34.7 bits (76), Expect = 0.084 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 G GGGG GGGGG G F GGGGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG G GGG G + GGGG G + GGG G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG G GGG G + GG GGG GGG G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG G GG GGGGG G + GG GGG Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGG 532 GG GG GGGGG G + + G GGGG GGG Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -3 Query: 681 GGXGGGGXXX-XGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGG GGGGG + GGGGG + GGG G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -3 Query: 681 GGXGGGGXXXXGGG-GGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGG G G + G GGGG + GGG G Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG----GGYGGGGYG 182 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 GG GGGG G G G G + GGGG Sbjct: 194 GGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGGG G GGGGGG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 567 VXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 V PPPPPP + PPPPPP PP Sbjct: 371 VGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPP A PPPPPP PP P Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPPP + + PPPP PP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPP A PPPPPP PP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 377 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPP + PPPPP PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPP 317 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PP V PPPPP PPPPPP PP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPP-------PPVGGPPPPPPPIEGRPP 386 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/53 (26%), Positives = 15/53 (28%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXPXXXXXXXXXXKKKXXXPP 737 PPPP PPPPP PP P + PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.3 bits (80), Expect = 0.028 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPPXXXF 694 P PPPPP PPPP PP F Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPF 488 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPP 482 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPP 483 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 472 PPPPPPPPPPPPPPPPFPP 490 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 477 PPPPPPPPPPPFPPPPPP 494 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 479 PPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP P Sbjct: 478 PPPPPPPPPPFPPPPPPTP 496 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 475 PPPPPPPPPPPPPFPPPPP 493 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPP PP Sbjct: 476 PPPPPPPPPPPPFPPPPPP 494 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPP 650 PPPPPP F PPPPPP Sbjct: 475 PPPPPPPPPPPPPF-----PPPPPP 494 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGG 532 GG GGGG GGGGG G GGGGG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXK 610 GG GGGG GGGGG G + + Sbjct: 94 GGGGGGGDGGGGGGGGGGGVGRAR 117 Score = 28.3 bits (60), Expect = 7.3 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GGGGG G GGGGGG GGG G Sbjct: 62 GGGGGG----GGGGGGGG-----------GGGGGGGGDDGDGGGGDGGGGG 97 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.5 bits (78), Expect = 0.048 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPP 682 + P PPPPP PPPP PP Sbjct: 681 MVPPPPPPPPPPPPPPPPPPP 701 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 686 PPPPPPPPPPPPPPPPQP 703 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 694 PPPPPPPPQPSTPPPPPP 711 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 564 VVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 +V PPPPPP PPPPPP PP P Sbjct: 681 MVPPPPPPPP---------PPPPPPPPPPPQPSTPPPPPP 711 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQP 703 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PP P P Sbjct: 688 PPPPPPPPPPPPPPQPSTP 706 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P P PP Sbjct: 689 PPPPPPPPPPPPPQPSTPP 707 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP P Sbjct: 696 PPPPPPQPSTPPPPPPSTP 714 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 35.5 bits (78), Expect = 0.048 Identities = 22/55 (40%), Positives = 26/55 (47%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXGXIF 517 GG GGGG GGGGG G + + GGGGGG + GGG G + Sbjct: 100 GGRGGGGGY--GGGGGYGGGGRS----YGGGGGGGGFYQD----SYGGGGGGGCY 144 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXP 553 GG GGG GGGGG G + + GGGGG Q P Sbjct: 111 GGGYGGGGRSYGGGGGGGGFYQDS---YGGGGGGGCYEIQIEP 150 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -1 Query: 668 GXGXXXXGGGGGXXGXXKXXXFFFXGGGGGGXXNXNXXPXLXXGG 534 G G GGGGG G + + GGGGGG P L G Sbjct: 115 GGGGRSYGGGGGGGGFYQDS---YGGGGGGGCYEIQIEPSLQHKG 156 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 864 PRRPPPPPPPPPPPPPPPP 882 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPPP F PPPPPP PP Sbjct: 195 PPPPPPPPPPG--FPGGAPPPPPPPFGAPPPP 224 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 626 PXXPPPPP--XXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPP 217 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 635 PPPPPXXXXPPPP 673 PPPPP PPPP Sbjct: 212 PPPPPPFGAPPPP 224 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 1161 PPPPPPPPSSPSPPPPPPP 1179 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 567 VXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 + PPPPPP PPPPPP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPP 1177 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPP 650 PPPPPP PPPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPP PP Sbjct: 1160 PPPPPPPPPSSPSPPPPPP 1178 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 1162 PPPPPPPSSPSPPPPPPPP 1180 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 PPPPP + PPPPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 614 FXLXPXXPPPPPXXXXPPP--PXPP 682 F + PPPPP PPP P PP Sbjct: 1150 FSVRDQIPPPPPPPPPPPPSSPSPP 1174 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P P PPP PPPP P Sbjct: 1168 PSSPSPPPPPPPPPPPPTP 1186 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.1 bits (77), Expect = 0.064 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 302 PAPPPPPPPGGAPPPPPPP 320 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 306 PPPPPGGAPPPPPPPP 321 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPP PP Sbjct: 318 PPPPPPPPGDGGAPPPPPP 336 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPP 322 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 319 PPPPPPPGDGGAPPPPPPP 337 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPP 647 PPPPPP A PPPPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P+PP PPPPP PPPPPP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPP------PPPPPPPGDGGAPPPPP 335 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP P PP PP Sbjct: 290 PVPPPPPADGSAPAPPPPP 308 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 35.1 bits (77), Expect = 0.064 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGG G F G G GG GGG G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGG GGGGG G + G GGG GGG G Sbjct: 1801 GGMAGGGGGMGGGGGGMGGGGE------GMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GGGGG G GGGG G GGG G Sbjct: 1757 GFGGGGGGGGMGGGGGMAG-----------GGGGMGGGGMAAGGGEFGGGEG 1797 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGG 532 GG GGGG GGG G GG GG GGG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 34.7 bits (76), Expect = 0.084 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 GG GGGG GGGGG G GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 150 GGGGGGGGGGGGGGGGGDG 168 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = -3 Query: 681 GGXGGGGXX-----XXGGGGGXXGXXKXKXFFFXXGGGGG 577 GG GGGG GGGGG G ++ GGGGG Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 647 GGGGGXXGXXKXXXFFFXGGGGGGXXN 567 GGGGG G ++ GGGGG N Sbjct: 242 GGGGGYSGGGSGNPHYYACGGGGGSYN 268 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PPPPPP PPPPPP PP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPP------LPGGAAPPPPPPIGGGAPPPPPP 705 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPP 650 PPPPPP + PPPPPP Sbjct: 210 PPPPPPPPEDDSIHNHEDLPPPPPP 234 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 30 PPPPPYEAPPPPPGPP 45 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP P Sbjct: 29 PPPPPPYEAPPPPPGP 44 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 56 PPPPPPPPPPPPPPPP 71 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPSSSP 75 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GG G G GGGGGG Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGG----XXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGGG G GGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 425 PPPPPPAPLPPPPPPP 440 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 426 PPPPPAPLPPPPPPPP 441 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 P P + +V PPPPPP A PPPPPP Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPP----------APLPPPPPP 439 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPP PPPP P Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPP PP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP P Sbjct: 425 PPPPPPAPLPPPPPPPPQP 443 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 233 PPPPPAAAPPPPPPPP 248 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 231 PAPPPPPAAAPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 P PPPP A PPPPPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P P PPP PPP PP Sbjct: 228 PAAPAPPPPPAAAPPPPPP 246 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PPP A PPPPPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.1 bits (72), Expect = 0.26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 1313 PPPPPPPPPPPPPLPP 1328 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPP 682 + P PPPP PPPP PP Sbjct: 1305 IQPPESPPPPPPPPPPPPPPP 1325 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP P Sbjct: 1312 PPPPPPPPPPPPPPLP 1327 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPP 682 + P PPPPP P PP PP Sbjct: 81 IPPPPPPPPPASNVPAPPPPP 101 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 564 VVXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 V+ PPPPPP PPPPPP Sbjct: 80 VIPPPPPPPPPASN------VPAPPPPPP 102 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPP PP Sbjct: 84 PPPPPPPASNVPAPPPPPP 102 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGGG G GGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGG-----------GGGGGG 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 61 GGGGGGGGGGGGGGGGGDG 79 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 75 PLCAPPPPPPPPPPPPPPP 93 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPP 647 PPPPPP F PPPPP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 534 PPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 PP + PPPPPP ++ PPPPPP P Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPP---SGKINPPPPPPPAMDKP 398 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP P Sbjct: 2 PPPPPPPGPPPPPSAP 17 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPP---PXXXXXPPXXXP 683 PPPPP K A PPPPP P PP P Sbjct: 341 PPPPPISKPPTSTRSA--PPPPPGRAPQPLGGPPPPPP 376 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GGGGG G + GGG G GGG G Sbjct: 206 GRGGGGRGGYGGGGGYGGYGGYDQY----SGGGYGGYGDSYGSYGGGGGYG 252 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 276 PLCAPPPPPPPPPPPPPPP 294 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 534 PPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 PP + PPPPPP ++ PPPPPP P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPP---SGKINPPPPPPPAMDKP 310 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPP---PXXXXXPPXXXP 683 PPPPP K A PPPPP P PP P Sbjct: 253 PPPPPISKPPTSTRSA--PPPPPGRAPQPLGGPPPPPP 288 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPP 682 + P PPPPP P PP PP Sbjct: 661 MFPPPPPPPPGGGVPGPPKPP 681 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPP PPPP PP Sbjct: 654 PPPPGGGMFPPPPPPP 669 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPP PP Sbjct: 653 PPPPPGGGMFPPPPPP 668 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 620 LXPXXP-PPPPXXXXPPPPXPP 682 L P P PPPP PPPP PP Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPP 181 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 614 FXLXPXXPPPPPXXXXPPPPXPP 682 F P PPPP PPPP PP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPP 110 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 100 PPYPPPPPYPPPPNPPYPP 118 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPP P + PP PPP PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 176 PPPYPPPPNPPYPPPPNPP 194 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 626 PXXP-PPPPXXXXPPPPXPP 682 P P PPPP PPPP PP Sbjct: 112 PNPPYPPPPNAPYPPPPNPP 131 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 626 PXXP-PPPPXXXXPPPPXPP 682 P P PPPP PPPP PP Sbjct: 191 PNPPYPPPPNAPNPPPPNPP 210 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP P PPPP A PP PPP PP P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPP-PNAPNPPYPPPPNAPNPPYPPP 236 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PP PPP A PPPP P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/43 (32%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +2 Query: 626 PXXP-PPPPXXXXPPPPXPPXXXFXXXXXXKKKXXXXPPXXXF 751 P P PPPP PPPP P + PP F Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP P PPPP PPPP PP P Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP + PPP PP PP PPP PP P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYP-----PPPYPPPPNPPYPPPPNP 193 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP P PPPP PPP P PP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PP PP PP + PP PPP PP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PP PPP A PPPP P PP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNP--PYPPPLYPP 163 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 534 PPXXKXXXXVVVXXPPPPPPXKK--KXXXFXXAXXPP-PPPPXXXXXPPXXXP 683 PP + PP PPP + PP PPPP PP P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP 202 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPPXXXFXXXXXXKKKXXXXPP 739 P P PPP PP P PP + PP Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 534 PPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PP PP PPP + PP PPP PP P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPN---PPYPPPPNPPYPPPPNAPNPPPPNP 209 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 212 PPSPPPPPPPPSPSPPRPP 230 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP PP Sbjct: 217 PPPPPPSPSPPRPPPPPPP 235 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXPXXXXXXXXXXKKKXXXPP 737 PPPPP + PPPPPP PP P K PP Sbjct: 204 PPPPPPR-------PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPP 222 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP P PP PP Sbjct: 215 PPPPPPPPSPSPPRPPPPP 233 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PP PPPPPP PPP P PP Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPP PP + PP PPP PP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 527 PXPPPXKXXGXGCXXXXXXXXXXXXXXXXFXLXPXXPPPPPXXXXPPPPXPP 682 P PPP G L PPPP PPPP PP Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Score = 31.5 bits (68), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP PP Sbjct: 191 PSGGPPPPPPPPPPPPPPP 209 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PPPP + PPPP PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 567 VXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 V PPPPP + + PPP P PP Sbjct: 106 VAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPP 140 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP P PPPP A PPPP PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPA---TRAPPPPPPIAPATGGPPPPPP 156 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 681 GGXGGGGXXXX--GGGGGXXGXXKXKXFFFXXGGGGG 577 GG GGGG GGGGG G + + GGGG Sbjct: 260 GGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGG 296 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP A PPPP PP P Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 638 PPPPXXXXPPPPXPP 682 PPPP PPPP PP Sbjct: 945 PPPPGGNAPPPPPPP 959 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 531 LPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 +PP PPPP PPPPPP PP Sbjct: 919 VPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP P PP PP Sbjct: 922 PPPPPGGNAPLPPPPP 937 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPP PPPP P Sbjct: 942 PSQPPPPGGNAPPPPPPP 959 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Frame = +2 Query: 626 PXXPPPP----PXXXXPPPPXPP 682 P PPPP P PPPP PP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPP 993 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 982 PPPPPP---PPPPPPP 994 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPPXXXFXXXXXXKKKXXXXPP 739 + P PPPPP PPPP PP +KK P Sbjct: 63 IPPTLPPPPPP---PPPPLPPPPPSGGNILLQKKSMTTKP 99 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P P PP PPPP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPP 77 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +2 Query: 620 LXPXXPPPPPXXXXPPPPXPPXXXFXXXXXXKKKXXXXPP 739 + P PPPPP PPPP PP +KK P Sbjct: 287 IPPTLPPPPPP---PPPPLPPPPPSGGNILLQKKSMTTKP 323 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P P PP PPPP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPP 301 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 P PP PPP PPPPPP PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPP 673 P PPPPP PPPP Sbjct: 82 PAAPPPPPPLPAPPPP 97 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPP PP Sbjct: 72 PAAPPPPAAPPAAPPPPPP 90 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPP PP Sbjct: 92 PAPPPPPAQPAPQPPPAPP 110 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPP 650 PPPPPP + F PPPPPP Sbjct: 64 PPPPPPRR----GFYDDYPPPPPPP 84 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP P PPPP PP Sbjct: 906 PAPPPPLPLAPEPPPPLPP 924 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PPPP PPPP P PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPP P PPPP PP Sbjct: 959 PPPIPATQVPPPPLPP 974 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 567 VXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 + PPP PP PPPP P PP P Sbjct: 176 ILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PP PP PPPP PP Sbjct: 200 PPAPPGALIPPPPAPP 215 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GG GG G GG GG GGG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGG--GGGG 574 GG GGGG GGGGG GG GGGG Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGG 103 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXK 610 GG GGGG GGGGG G + + Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRGR 537 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 85 GGGGGGGGGVGGGGGGGGG 103 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 86 GGGGGGGGVGGGGGGGGGG 104 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 87 GGGGGGGVGGGGGGGGGGG 105 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 672 GGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GGGG GGGGG G GGGGGG Sbjct: 80 GGGGCGGGGGGGGGVGGG-------GGGGGGGG 105 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 311 GGDGGGGGGGGGGGGGDGG 329 Score = 28.3 bits (60), Expect = 7.3 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG GGGGG G GG GGG G G G Sbjct: 306 GDGGGGGDGGGGGGGGGG----------GGGDGGGDGDGDGDGDGDGDGDG 346 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP + P PPPP PP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPP--PPEPPEECP 587 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PP PP Sbjct: 573 PKPPPPPPEPPEECPPPPP 591 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGG--GGGXXXQPXPXXFXGGGXG 526 GG GGG GGGGG G GGG GGG GGG G Sbjct: 244 GGATGGGGGATGGGGGATGGGGGAT---GGGGGATGGGGGATGGGGGATGGGGG 294 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGG GGGGG G GGGGG GG G Sbjct: 279 GGATGGGGGATGGGGGATGGGGG-----ATGGGGGATGVGGGATGGGGGATG 325 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 GG GGG GGGGG G GGGGG Sbjct: 321 GGATGGGVGATGGGGGATGGGGG-----VTGGGGG 350 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 487 GGFGGGGGASGGGGGGGGG 505 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 343 GGGGGGGGGGGGGGGGGRG 361 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGGG G Sbjct: 344 GGGGGGGGGGGGGGGGRGG 362 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 G GGGG GGGGG G + GGGGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGR--------GGGGG 365 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGG 634 GG GGGG GGGGG Sbjct: 342 GGGGGGGGGGGGGGGG 357 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGG 634 GG GGGG GGGGG Sbjct: 350 GGGGGGGGGGRGGGGG 365 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PP P PP Sbjct: 463 PPPPPMSPPPPTPPPP 478 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 P PPP PPPP PP Sbjct: 461 PIPPPPPMSPPPPTPP 476 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPPP PPPPPP PP Sbjct: 195 PPPPPPGP--------GGIPPPPPPIRGGVPP 218 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPP PP Sbjct: 196 PPPPPGPGGIPPPPPP 211 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPP PPPP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPP PPPP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP P Sbjct: 122 PPPPPTGTLPPPPVTP 137 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 626 PXXPPPPP--XXXXPPPPXPP 682 P PPPPP PPPP PP Sbjct: 786 PEYPPPPPGLARPNPPPPNPP 806 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 P PPP PPPP PP Sbjct: 171 PSPPPSGAPPPPPPPP 186 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GG GGG G G + GG GGG + GG G Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGG G + + G GGG Sbjct: 213 GGRGGGGYGGGHGGGGYGGGGRHD---YGGGSKGGG 245 Score = 28.3 bits (60), Expect = 7.3 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 681 GGXGGGGXXXXG--GGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 G GGGG G GGG G K + G GGGG + GG G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGG---YGGGSGGGGYGGGRGGGGYGGGHGG 226 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGG G + GGG G + GG G Sbjct: 763 GGYGGGGGGYRGGGGYGGGHRGGGGY---GGGGHRGGSYSGYRGSYKSGGYG 811 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXG---GGGGGXXXQPXPXXFXGGGXG 526 GG GGGG G GGG + G GGG G + GGG G Sbjct: 166 GGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGG 220 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 P+PP VV PPP PP + PPPPPP P Sbjct: 283 PVPPMTPPP--AVVTAPPPAPPLPN-----FTSPSPPPPPPLPPAMP 322 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 528 PLPPXXKXXXXVV---VXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PLPP ++ V PPPPPP + + P P PP P P Sbjct: 316 PLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSM-PSSLPMPSPPEDLYDAPATLP 369 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP P Sbjct: 142 PPPPPPPPSPPPPCHP 157 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPP PPPP P PP Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGG GGGGG GGGGGG Sbjct: 57 GGCGGGDDDDDGGGGGDDDDDDDD----DDGGGGGG 88 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 672 GGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GGG GGGGG G GGGGG GGG G Sbjct: 46 GGGVGDDDGGGGGCGGGDD------DDDGGGGGDDDDDDDDDDGGGGGG 88 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PP PP A P PPPP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPP 191 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/42 (33%), Positives = 14/42 (33%), Gaps = 1/42 (2%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPP-PPXKKKXXXFXXAXXPPPPPP 650 P PP PPPP P F PPPPP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPP + + + PP PP PP Sbjct: 300 PPPPPQQAARIDYRASYGAPPLPPKRGGGPP 330 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 579 PPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PPPPP + + + PP PP PP Sbjct: 441 PPPPPQQAARINYRASYGAPPLPPKRGGGPP 471 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGG 532 GG GGG GGGGG G GGGGG GGG Sbjct: 59 GGATGGGGGATGGGGGATGGHGGAT------GGGGGATGDGGGATGGGGG 102 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGGG GGGG G + + G GGG Sbjct: 209 GGRGGGGYGGGRGGGGGYGGGRRD---YGGGSKGGG 241 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPP 650 PPPPPP A PPPPPP Sbjct: 755 PPPPPPPAVPG---EGARPPPPPPP 776 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGG 580 GG GGG GGGG G + + GGGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 Query: 671 GGXGXXXXGGGGGXXGXXKXXXFFFXGGGGGG 576 GG G GGGG G + + GG GGG Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 G G GG GGGGG G + + G GGGG Sbjct: 312 GGGRGGGYRSGGGGG-YGGGRGGGRGYGGGRGGGG 345 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGG 532 GG G G GGGG G + + G GGGG GGG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGG---YGGGRGGGGYGGGRGGGGSYGGG 138 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPP PPPP P Sbjct: 199 PSGAPPPPPIGAPPPPPP 216 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PP P PP Sbjct: 466 PPPPPAPALPPLPLPP 481 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGG 577 GG GG G G GGG G + + GGGG Sbjct: 160 GGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGG 634 GG GGGG GGGGG Sbjct: 3699 GGYGGGGGGYGGGGGG 3714 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP PPPP P Sbjct: 98 PATPPPPTMPPTPPPPQTP 116 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 211 PPPPPP--PPPPPPPP 224 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGG 580 GG GGGG GG G K GGGG Sbjct: 7 GGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGG 40 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGG 580 GG GGGG GG G K GGGG Sbjct: 47 GGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGG 80 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 5/41 (12%) Frame = +3 Query: 576 PPPPPPXK-----KKXXXFXXAXXPPPPPPXXXXXPPXXXP 683 PPPPPP A PPPP P PP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PP P PPPP PP Sbjct: 303 PPPPPLPAGVPAPPPPPPP 321 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PP PP PPP PP Sbjct: 526 PPSPPAPPPKPAPPPRSPP 544 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 28.3 bits (60), Expect = 7.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 528 PLPPXXKXXXXVVVXXPPPPPPXKKKXXXFXXAXXPPPPPP 650 P+PP K V PPPP P A PP PP Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPPPDSSE--AQAQQPPLSPP 292 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPP PPPP PP Sbjct: 258 PTKPPPRVASRRPPPPLPP 276 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P P PPP PPP PP Sbjct: 1059 PRKPSPPPSEPAPPPRQPP 1077 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 528 PLPPXXKXXXXV-VVXXPPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 PLPP K V PPP P PPPP PP Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 24.6 bits (51), Expect(2) = 7.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +3 Query: 537 PXXKXXXXVVVXXPPPPPPXKKK 605 P + ++ PPPPPP +K Sbjct: 836 PSREEGPSLITAEPPPPPPVARK 858 Score = 21.8 bits (44), Expect(2) = 7.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 633 PPPPPPXXXXXP 668 PPPPPP P Sbjct: 886 PPPPPPPVMKKP 897 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +3 Query: 576 PP--PPPPXKKKXXXFXXAXXPPPPPPXXXXXP 668 PP PPPP PPPPPP P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIP 713 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXG 625 GG GGGG GGGG G Sbjct: 468 GGFGGGGGPNGAGGGGGGG 486 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPP P PP PP Sbjct: 1266 PPFMPPPPRMQPPGPPGPP 1284 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%), Gaps = 2/18 (11%) Frame = +2 Query: 635 PPPPPX--XXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 425 PPPPPGFPQFQPPPPPPP 442 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXG 625 G GGGG GGGGG G Sbjct: 87 GDGGGGGDGDGGGGGDGG 104 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 681 GGXGGGGXXXXGGGGGXXGXXKXKXFFFXXGGGGGG 574 GG GGG GGG + GGGGG Sbjct: 357 GGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXPP 682 P PPPPP PP P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGP 1678 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXG 625 G GGGG GGGGG G Sbjct: 102 GDGGGGGDGDGGGGGDGG 119 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 635 PPPPPXXXXPPPPXPP 682 PPPPP PPPP PP Sbjct: 794 PPPPP----PPPPPPP 805 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 576 PPPPPPXKKKXXXFXXAXXPPPPPPXXXXXPP 671 P PP P K PPPPPP PP Sbjct: 343 PQPPTPTTPKTHP--QLGPPPPPPPPPPTPPP 372 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 635 PPPPPXXXXPPPP 673 PPPPP PPPP Sbjct: 123 PPPPPGVFTPPPP 135 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 678 GXGGGGXXXXGGGGGXXG 625 G GGGG GGGGG G Sbjct: 1003 GGGGGGGGGGGGGGGRRG 1020 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -3 Query: 681 GGXGGGGXXXX---GGGGGXXGXXKXKXFFFXXGGGGGGXXXQPXPXXFXGGGXG 526 GG GGGG GGGG G + F GGG P G G Sbjct: 2323 GGFGGGGSSRIRPGGGGGYSGGGVESDRHVFVVAGGGASFNNGSDPVNESGVNKG 2377 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 626 PXXPPPPPXXXXPPPPXP 679 P PPPPP PPPP P Sbjct: 375 PFAPPPPPP--PPPPPAP 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,998,272 Number of Sequences: 59808 Number of extensions: 272102 Number of successful extensions: 5569 Number of sequences better than 10.0: 104 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2377 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -