BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G17 (902 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0426 + 20667639-20667938 30 2.2 06_02_0187 + 12805788-12807007,12807059-12807186,12807811-128078... 29 5.1 06_01_1082 - 8847795-8848033,8848511-8848724 28 8.8 >06_03_0426 + 20667639-20667938 Length = 99 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = -2 Query: 184 SRSWLEVSADSSTTPALAASMHIANTTRSFILLGAFQDRLQVCKS 50 SR++L S S + A+AAS + +R LL +QDR Q+C+S Sbjct: 50 SRTFLLWSLKVSRSYAMAASSAVLKVSRVVKLLRWWQDREQLCRS 94 >06_02_0187 + 12805788-12807007,12807059-12807186,12807811-12807859, 12808508-12808853 Length = 580 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = -2 Query: 310 LSMIRLLTTFWMMEPLPWL-----SYSKL*RTALS*SPVRMLLYSFSSRSWLEVSADSST 146 L+++ L+ W + P L + S L SP + SF S + S D++T Sbjct: 36 LALLTLIMALWQLHPYQPLVLLPAALSSSPCPLLPRSPTSGIAVSFLSTAAATNSTDTAT 95 Query: 145 TPALAASMHIANTTR 101 P A+ +A TTR Sbjct: 96 VPTTTAAARVAATTR 110 >06_01_1082 - 8847795-8848033,8848511-8848724 Length = 150 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 652 RVVYGGNSADSTR--EXWFFQPAKYENDVLFFIYNRQFNDALELG 780 + Y G++A R + W Y DVL F YN++++D +G Sbjct: 42 KTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHDVAVVG 86 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,121,641 Number of Sequences: 37544 Number of extensions: 449567 Number of successful extensions: 1306 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1306 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -