BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G17 (902 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.45 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.45 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 32 0.60 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 2.4 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 7.4 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 7.4 At1g61620.1 68414.m06943 expressed protein contains Pfam profile... 28 7.4 At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00... 28 9.7 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.45 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +3 Query: 150 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 317 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.45 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +3 Query: 150 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 317 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 297 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 395 +++D + EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 123 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 224 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 189 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 305 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 189 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 305 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At1g61620.1 68414.m06943 expressed protein contains Pfam profile: PF01363 FYVE zinc finger Length = 310 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 712 AKYENDVLFFIYNRQFNDALELGTNRERLGR 804 +K ND+ +F Y+ + L GT RERLGR Sbjct: 6 SKNNNDLAYFTYDEK--KKLGYGTQRERLGR 34 >At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box only protein 7 (SP:Q9Y3I1) {Homo sapiens} ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 350 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 172 LEVSADSSTTPALAASMHIANTTRSFILLGAFQDRLQVCK 53 LE S D+S ALA S+H F+LL D+ K Sbjct: 54 LEKSGDTSDLTALALSVHAVMLESGFVLLDHGSDKFSFSK 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,457,751 Number of Sequences: 28952 Number of extensions: 347751 Number of successful extensions: 916 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -