BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G16 (918 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0197 + 21884415-21885332,21886130-21886750 29 5.2 01_01_1082 - 8516525-8517409 29 5.2 01_01_0363 + 2850954-2853675,2853819-2854225 29 5.2 >03_05_0197 + 21884415-21885332,21886130-21886750 Length = 512 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 256 RTGVPPPNAFKKSIRLAQGAWWIVLVVDSVSHCXLN 363 R+ PPP KK +RL G W + L V S+ H L+ Sbjct: 29 RSWWPPPEKEKKKLRLPPGPWQLPL-VGSLHHVLLS 63 >01_01_1082 - 8516525-8517409 Length = 294 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/64 (31%), Positives = 32/64 (50%) Frame = +1 Query: 64 ASXLTFLQKLIEXSQXN*LRXSWLTRHFG*TKKLILAPVGLQKRWANRLENKTKTKMQEH 243 A LT L ++++ + L +TRHF K LAP+ + R A + K+ K ++ Sbjct: 198 AQALTLLNRMLKLKEQG-LHGEQITRHF---IKSWLAPIKERSRTAFEFDGKSDPKREDP 253 Query: 244 GSLE 255 SLE Sbjct: 254 ESLE 257 >01_01_0363 + 2850954-2853675,2853819-2854225 Length = 1042 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 129 MVDKTLWLNEEANSGSGRAAKT 194 + D+T+WL+EEAN G A T Sbjct: 963 IADRTIWLHEEANDTDGTNAST 984 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,132,876 Number of Sequences: 37544 Number of extensions: 288620 Number of successful extensions: 788 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -