BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G15 (883 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024785-6|AAF60605.2| 467|Caenorhabditis elegans C-type lectin... 29 4.4 U80847-1|AAB37983.2| 738|Caenorhabditis elegans Hypothetical pr... 28 7.7 >AC024785-6|AAF60605.2| 467|Caenorhabditis elegans C-type lectin protein 74 protein. Length = 467 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 512 TLTFTAVFPSISDLQLSNAE--VFSYVHEINPKFILGPLLSFSLDSETQS 655 ++T T P S+ Q+ + +F+Y +++NP ++ L SLDS+ S Sbjct: 155 SVTKTTTTPDSSNCQVGGPQTVLFAYSNDLNPFIVMDTLQRSSLDSQNVS 204 >U80847-1|AAB37983.2| 738|Caenorhabditis elegans Hypothetical protein C17H11.2 protein. Length = 738 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 194 NCIREYFSRNSQCQLVRGPVPDPLPLSYYRVDI 292 N R+ ++ +CQ++R VP P P+S V + Sbjct: 146 NSFRDCYNLYKKCQMLRPGVPVPRPMSLLNVSV 178 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,763,342 Number of Sequences: 27780 Number of extensions: 302323 Number of successful extensions: 738 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -