BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G11 (890 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 26 1.3 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 26 1.8 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 25 3.1 DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted ... 24 5.4 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 24 5.4 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 24 7.1 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 7.1 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 26.2 bits (55), Expect = 1.3 Identities = 20/75 (26%), Positives = 27/75 (36%) Frame = +1 Query: 121 CACVNAAKITYKICVPSQHLKACQDMVDIPTKSKVTLDCIPARDRMECLNYVQQRQADFV 300 CAC A Y +C P++ L C T T C D +C+ Y R A Sbjct: 22 CACPYAHPYPYDLCGPNEELLEC------GTACPKT--CADLNDPPKCVRYSVYRDASAS 73 Query: 301 PVDPEDMYVAAKIPN 345 E +Y+ N Sbjct: 74 LDSSESLYMGNAFRN 88 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +3 Query: 684 YNKLCSMCEHPERCDYPDEFSGYVGALKVSGSQQRTSRLHPSHIHQEILRIAR 842 YN S+ ++P+ C D + Y G +Q R +++ E+L+ A+ Sbjct: 235 YNLAMSIAKYPQLCIRHDRDAAYYGTFSAESFEQALER-EAANVTVELLQEAK 286 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 25.0 bits (52), Expect = 3.1 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 Query: 121 CACVNAAKITYKICVPSQHLKAC 189 CAC A Y +C P++ + C Sbjct: 22 CACPYAHPYPYDVCGPNEEFQTC 44 >DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted polypeptide protein. Length = 144 Score = 24.2 bits (50), Expect = 5.4 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -2 Query: 367 PGKRQSPDWVFWRPRTCLPGRLERNRLASAERNSDTPFYLWRECSLV 227 P R S + W P LP + +S++ + F +W+ S+V Sbjct: 43 PCNRLSNSYGLWTPWKMLPDKFIERSNSSSQPSPFVAFKVWQTKSIV 89 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 24.2 bits (50), Expect = 5.4 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 Query: 121 CACVNAAKITYKICVPSQHLKAC 189 CAC A Y +C P++ + C Sbjct: 22 CACPYAHPYPYDLCGPNEEFQEC 44 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 23.8 bits (49), Expect = 7.1 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 400 FRYEAVIVIHK--DLPIDNLDQLKGLKSCHTGVNRN 501 FR + +++ H D P D +D LK L+S ++RN Sbjct: 111 FRQKDMLLRHMSGDFPRDYVDTLKQLRSPLLSISRN 146 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.8 bits (49), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 355 QSPDWVFWRPRTCLPGRLERNRLASAE 275 +SP W W + LP NRL SA+ Sbjct: 5 KSPLWQHWLRSSVLPCGTTSNRLLSAQ 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 965,438 Number of Sequences: 2352 Number of extensions: 21203 Number of successful extensions: 39 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -