BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G10 (857 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.4 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 5.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 5.4 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 93 NLFYIFATTLGVC*RRSLRTF*LRGRLLDQRAILKGDTLVTSLGTN 230 NL+Y F + RSL+ G +L++ + + LV SL N Sbjct: 178 NLYYSFYISDKAARPRSLQFVDSEGNILEEFVLSRAGGLVNSLYQN 223 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 71 DTTQNEYKSVLYLRYNSGCV 130 D T+ +YKS+ L+Y C+ Sbjct: 32 DDTKPDYKSLQELKYMERCI 51 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 9.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 310 LSVVTSFSKESIIVLSQSAKDLASPHLFVPSDVTRVSPL 194 LS ++S + +VL + +ASP + V S SPL Sbjct: 687 LSGLSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPL 725 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 9.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 310 LSVVTSFSKESIIVLSQSAKDLASPHLFVPSDVTRVSPL 194 LS ++S + +VL + +ASP + V S SPL Sbjct: 579 LSGLSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPL 617 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 539 GLQGVRSQKTRRRSSAEIRHDW*SPQHL 622 G G ++ SS+ RH+W + HL Sbjct: 414 GGSGQNQPESPESSSSTPRHEWVAQNHL 441 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,640 Number of Sequences: 336 Number of extensions: 4333 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -