BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G10 (857 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0610 - 25449085-25453284 39 0.004 07_03_1507 - 27228032-27228742 30 2.1 01_06_0554 + 30179641-30179658,30179725-30180126,30180580-301808... 29 3.6 07_01_0378 + 2826421-2826427,2827286-2827375,2827400-2827639,282... 28 8.3 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 28 8.3 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = -3 Query: 390 LVLSPPGPKTLVP*A*PVSLPRSSLKISLL*PAFPKSPSSFCPKVPKTLPPPICLS 223 ++LSPP K+L P A PVSLP +K SL P P +P S P V K+LPPP +S Sbjct: 1254 VILSPPAVKSLPPPA-PVSLPPPPVK-SL--P--PPAPVSLPPPVVKSLPPPAPVS 1303 >07_03_1507 - 27228032-27228742 Length = 236 Score = 30.3 bits (65), Expect = 2.1 Identities = 29/74 (39%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = -3 Query: 423 SCSPSLGVRRSLVLSPPGPKTLVP*A*PVSLPRSSLK---ISLL*PAFPKSPSSFCPKVP 253 S SPS R LSPP P T + P SL R+S + IS+ AFP +PS+ P P Sbjct: 39 SLSPSDSCSRRAPLSPPSPSTFG--SPPTSL-RTSFRLGVISIGFAAFPSTPSA-SPFRP 94 Query: 252 KTLPPPICLSQVTS 211 T P S T+ Sbjct: 95 PTAGAPSSSSSRTA 108 >01_06_0554 + 30179641-30179658,30179725-30180126,30180580-30180892, 30180966-30181358,30181442-30182427 Length = 703 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 71 DTTQNEYKSVLYLRYNSGCVLTQKFTDLLITRKITRSAGNPQGRHPRDV 217 D + EY+ +L+ RY+ L K+ RS+G+PQG+ P D+ Sbjct: 67 DNSLREYEFLLF-RYDDNMHFMVLPFGLNACEKVIRSSGSPQGKLPCDI 114 >07_01_0378 + 2826421-2826427,2827286-2827375,2827400-2827639, 2827722-2828035,2828604-2828696,2828789-2828977 Length = 310 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/75 (24%), Positives = 28/75 (37%), Gaps = 3/75 (4%) Frame = +2 Query: 164 RKITRSAGNPQGRHPRDVTWDKQMGGGKVFGTLGQN---DDGLFGKAGYNREIFNDDRGK 334 R ++ + NP R W + G G +G G N G FG + ++ + Sbjct: 82 RNLSANVNNPVSRPMPQRPWQQTSGYGNTYGGYGSNMYSSYGGFGNTYGSGGLYGNSMYS 141 Query: 335 LTGQAYGTRVLGPGG 379 G YG + G G Sbjct: 142 SYGGGYGGSLYGGSG 156 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 393 YGGRLDWANKNAQATIDLNRQI 458 +GG L W N + ++T+D +RQ+ Sbjct: 963 HGGSLPWKNTDFESTVDFDRQL 984 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,441,884 Number of Sequences: 37544 Number of extensions: 519450 Number of successful extensions: 1476 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -