BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G09 (878 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 26 6.1 SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa... 26 8.1 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 319 TPLPALAPSRPSDFIYFISFSVD 251 TPLP PS+PS F+ S S D Sbjct: 399 TPLPPSTPSKPSTFVRPHSSSTD 421 >SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 200 RHQRFHSRVRAHAHVRLDQHQRQYPSRDEEG 108 RH+ HSR R H R D+ +R PS E G Sbjct: 27 RHRHHHSRHRESKHGRHDRSER--PSSREAG 55 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,522,324 Number of Sequences: 5004 Number of extensions: 36702 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -