Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP05_F_G09
         (878 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0009 + 22134160-22134696                                         31   1.6  

>04_04_0009 + 22134160-22134696
          Length = 178

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +3

Query: 177 PTMETLVPKQVWALILILAGMATTTSTLKLIK*MKSLGRDGAKAGN 314
           P+M  LVP  +  L+L LA M TTTS+          GR+GA  G+
Sbjct: 129 PSMLMLVPVAMLVLLLALAFMPTTTSSSSSAGGGGGGGRNGATTGH 174


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,636,980
Number of Sequences: 37544
Number of extensions: 278005
Number of successful extensions: 492
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 478
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 492
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2479731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)