BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G08 (795 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 37 0.021 03_05_0067 - 20460206-20460703,20461255-20461530 34 0.15 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 33 0.20 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 32 0.60 09_06_0125 - 21011757-21012428 31 1.4 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.4 12_02_0928 + 24488891-24489675,24490369-24490421,24490479-244912... 30 1.8 04_04_0714 + 27496678-27497392,27499080-27499138,27499179-27499370 30 1.8 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 2.1 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 30 2.4 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 3.2 12_02_0299 - 17051570-17052474,17053542-17053755 29 4.0 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 4.3 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 29 4.3 03_01_0515 - 3864796-3865425 29 4.3 02_05_0686 - 30900748-30902167,30903442-30904742 29 4.3 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 29 4.3 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.3 12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325,680... 29 5.6 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 5.6 11_01_0133 + 1121392-1122731,1123417-1123858 29 5.6 02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182... 29 5.6 02_03_0367 + 18220099-18220905 29 5.6 11_01_0359 - 2731522-2732346 28 7.4 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 28 7.4 06_03_1153 - 28047125-28047751 28 7.4 02_03_0279 + 17250347-17252098 28 7.4 01_06_1724 - 39452858-39454309 28 7.4 09_02_0603 - 11150739-11150746,11150791-11151340 28 9.8 09_02_0327 - 7284829-7284889,7284946-7286126 28 9.8 07_03_0890 - 22332768-22333382 28 9.8 07_01_0080 + 587674-588510 28 9.8 03_04_0231 + 19050105-19050567,19051376-19052648,19052743-19054171 28 9.8 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 28 9.8 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 36.7 bits (81), Expect = 0.021 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXF 560 PPPP FF PPPPPP F Sbjct: 68 PPPPAAFFAAVPPPPPPPF 86 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 631 VFFXXPPPPXXFFFXXPPPPPP 566 VF PPPP FF PPPPP Sbjct: 62 VFAAAPPPPPAAFFAAVPPPPP 83 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = -3 Query: 616 PPPPXXF--FFXXPPPPPPXFXXXXXXXXXPP 527 PPPP F PPPPP F PP Sbjct: 54 PPPPQVIRVFAAAPPPPPAAFFAAVPPPPPPP 85 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 33.9 bits (74), Expect = 0.15 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXF 560 PPPP +F PPPPPP + Sbjct: 14 PPPPPQYFQAGPPPPPPQY 32 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXF 560 PPPP F PPPPP F Sbjct: 15 PPPPQYFQAGPPPPPPQYF 33 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP ++ PPPPPP PP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPP 111 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 31.9 bits (69), Expect = 0.60 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 628 FFXXPPPPXXFFFXXPPPPPP 566 ++ PPPP + PPPPPP Sbjct: 5 YYNNPPPPHSSYAAPPPPPPP 25 >09_06_0125 - 21011757-21012428 Length = 223 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP F PPPPPP Sbjct: 172 PPPPPRAPFLAPPPPPP 188 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP F PPPPPP Sbjct: 357 PPPPPPFAPTLPPPPPP 373 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 625 FXXPPPPXXFFFXXPPPPPP 566 F PPPP PPPPPP Sbjct: 409 FVQPPPPPTHTHGPPPPPPP 428 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 637 RXVFFXXPPPPXXFFFXXPPPPPP 566 R F PPPP PPPPPP Sbjct: 406 RNPFVQPPPPPTHTHGPPPPPPPP 429 >12_02_0928 + 24488891-24489675,24490369-24490421,24490479-24491229, 24491322-24491533,24491780-24492570,24492686-24492784 Length = 896 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXG 518 PPP F PPPPPP PP G Sbjct: 158 PPPAISLPFALPPPPPPPKAMAMMAMDTPPTKG 190 >04_04_0714 + 27496678-27497392,27499080-27499138,27499179-27499370 Length = 321 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 649 GXGXRXVFFXXPPPPXXFFFXXPPPPPPXF 560 G G +F P F F PPPPPP + Sbjct: 195 GTGLDYTYFTMPDALLEFGFTLPPPPPPYY 224 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGGXGXK 503 PPP PPPPPP PP G G K Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNK 661 Score = 25.8 bits (54), Expect(2) = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Frame = -3 Query: 616 PPPPXXF--FFXXPPPPPP 566 PPPP F PPPPPP Sbjct: 551 PPPPSGNKPAFSPPPPPPP 569 Score = 22.6 bits (46), Expect(2) = 2.1 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = -3 Query: 583 PPPPPPXFXXXXXXXXXPP 527 PPPPPP PP Sbjct: 587 PPPPPPPLPNCLVPSPPPP 605 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGGXG 509 PPPP PPPPPP PP GG G Sbjct: 1099 PPPPSIGAGAPPPPPPP---GGITGVPPPPPIGGLG 1131 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 613 PPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGG 515 PPP PPPPPP PP GG Sbjct: 296 PPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGG 328 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGG 515 PPPP PPPPPP PP GG Sbjct: 273 PPPPPQ----APPPPPPNAPMGMPPRIPPPPVGG 302 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 628 FFXXPPPPXXFFFXXPPPPPPXF 560 F+ PPPP PPPPPP F Sbjct: 316 FYPSPPPPPP----PPPPPPPSF 334 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 610 PPXXFFFXXPPPPPP 566 PP F+ PPPPPP Sbjct: 311 PPLPSFYPSPPPPPP 325 Score = 24.6 bits (51), Expect(2) = 4.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 Query: 625 FXXPPPPXXFFFXXPPPPPP 566 F P P F PPPPPP Sbjct: 275 FPFPHLPPIFSPPSPPPPPP 294 Score = 23.0 bits (47), Expect(2) = 4.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 583 PPPPPPXF 560 PPPPPP F Sbjct: 290 PPPPPPAF 297 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP PPPPPP PP Sbjct: 1170 PPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 1169 PPPPPPLSPSLPPPPPP 1185 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 637 RXVFFXXPPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGG 515 R V PPPP PPPPPP + P G Sbjct: 44 RWVVLPYPPPPPP-MVAAPPPPPPQYAKHFAAGPPPAAAAG 83 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP PPPPPP PP Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPPPPPLPP 90 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP PPPPPP PP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPP 345 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXG 518 PPPP PPPPPP PP G Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGG 385 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 49 PPPPPYQVMPVPPPPPP 65 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.1 bits (62), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPP ++ PPPPPP Sbjct: 115 PPPHLLHYYGHPPPPPP 131 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP + PPPPP Sbjct: 114 PPPPHLLHYYGHPPPPP 130 >12_01_0752 - 6798938-6799312,6799628-6799768,6800257-6800325, 6800407-6800454,6801740-6801836,6801922-6802001, 6802099-6802170,6802335-6802429,6802853-6802934, 6805476-6805853 Length = 478 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 631 VFFXXPPPPXXFFFXXPPP 575 VF PPPP FF PPP Sbjct: 53 VFAAAPPPPRAAFFAPPPP 71 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPPXXGGXG 509 PPPP PPPPPP PP G Sbjct: 150 PPPPQESTPPPPPPPPPAPVAAAVSAPAPPSPASQG 185 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 149 PPPPPQESTPPPPPPPP 165 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 153 PPPPPTSVAALPPPPPP 169 >02_04_0289 + 21615745-21616155,21617417-21617870,21618162-21618217, 21618307-21618437,21618565-21618727 Length = 404 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 613 PPPXXFFFXXPPPPPPXF 560 PPP PPPPPP F Sbjct: 54 PPPHGMVAAAPPPPPPQF 71 >02_03_0367 + 18220099-18220905 Length = 268 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 613 PPPXXFFFXXPPPPPP 566 PPP F PPPPPP Sbjct: 183 PPPSSLFPPLPPPPPP 198 >11_01_0359 - 2731522-2732346 Length = 274 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP + PPPPP PP Sbjct: 54 PPPPHAYHHHHYPPPPPPHHHPYPPHPPPP 83 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 55 PPPPPRTLPPPPPPPPP 71 >06_03_1153 - 28047125-28047751 Length = 208 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Frame = -3 Query: 616 PPPPXXFF---FXXPPPPPPXF 560 PPPP F PPPPPP F Sbjct: 9 PPPPAIFCPPPLSPPPPPPPIF 30 >02_03_0279 + 17250347-17252098 Length = 583 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP PPPPPP F PP Sbjct: 124 PPPPPP----PPPPPPPLFAKPDLDSTAPP 149 >01_06_1724 - 39452858-39454309 Length = 483 Score = 28.3 bits (60), Expect = 7.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 613 PPPXXFFFXXPPPPPP 566 PPP + PPPPPP Sbjct: 347 PPPPCLAYQMPPPPPP 362 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 631 VFFXXPPPPXXFFFXXPPPPP 569 + + PPPP + PPPPP Sbjct: 342 IAYQMPPPPCLAYQMPPPPPP 362 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 4/21 (19%) Frame = -3 Query: 616 PPPPXXFFFXXPP----PPPP 566 PPPP FF PP PPPP Sbjct: 63 PPPPLGSFFVPPPQSRVPPPP 83 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 637 RXVFFXXPPPPXXFFFXXPPPPPP 566 R +F PPPP PPPPPP Sbjct: 46 RIIFGAHPPPPPP---PPPPPPPP 66 >07_03_0890 - 22332768-22333382 Length = 204 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 75 PPPPPAEATPPPPPPPP 91 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXFXXXXXXXXXPP 527 PPPP PPPPPP PP Sbjct: 76 PPPPAEATPPPPPPPPPPERAVPEAADTPP 105 >07_01_0080 + 587674-588510 Length = 278 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 94 PPPPPPSSGSPPPPPPP 110 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 95 PPPPPSSGSPPPPPPPP 111 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPPXF 560 PPPP PPPPPP F Sbjct: 105 PPPPPPPPPPPPPPPPPLF 123 >03_04_0231 + 19050105-19050567,19051376-19052648,19052743-19054171 Length = 1054 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 P PP + PPPPPP Sbjct: 86 PLPPPVLLYLQPPPPPP 102 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 616 PPPPXXFFFXXPPPPPP 566 PPPP PPPPPP Sbjct: 362 PPPPKLNTAPKPPPPPP 378 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,481,334 Number of Sequences: 37544 Number of extensions: 267463 Number of successful extensions: 3491 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2982 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -