BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G06 (896 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0070 + 27479654-27479672,27479864-27479922,27480339-274803... 119 4e-27 01_06_0260 - 27959188-27959251,27959342-27959424,27960220-279603... 119 4e-27 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 29 3.8 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 29 6.6 01_01_0668 - 5109476-5110112,5110196-5110439,5110519-5110917,511... 28 8.8 >05_07_0070 + 27479654-27479672,27479864-27479922,27480339-27480378, 27480477-27480565,27481065-27481147,27481219-27481282 Length = 117 Score = 119 bits (286), Expect = 4e-27 Identities = 51/83 (61%), Positives = 64/83 (77%) Frame = +2 Query: 101 KRLELLGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 280 K+ ++GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK C + A Sbjct: 31 KKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGKVKA 90 Query: 281 GGAWVFSTTAASSCRSAVRRLRE 349 GGA+ +T +A + RS +RRLRE Sbjct: 91 GGAYTMNTASAVTVRSTIRRLRE 113 >01_06_0260 - 27959188-27959251,27959342-27959424,27960220-27960308, 27960388-27960427,27960938-27960981,27961240-27961288 Length = 122 Score = 119 bits (286), Expect = 4e-27 Identities = 51/83 (61%), Positives = 64/83 (77%) Frame = +2 Query: 101 KRLELLGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 280 K+ ++GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK C + A Sbjct: 36 KKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGKVKA 95 Query: 281 GGAWVFSTTAASSCRSAVRRLRE 349 GGA+ +T +A + RS +RRLRE Sbjct: 96 GGAYTMNTASAVTVRSTIRRLRE 118 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 787 GSPXPXGRGXGVXGXGXGRAXNXQTAFSRGXGD 689 G+P P G G G G G ++ ++RG GD Sbjct: 193 GAPSPAGGGGGGGGGGYNKSGGGGGGYNRGGGD 225 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 209 CGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRRLR 346 C +KR+ G W C RC+ + + A +S R RR+R Sbjct: 58 CLNPPLKRAPPGNWQCPRCRTKKVSLKLLDNADADTSKRERTRRMR 103 >01_01_0668 - 5109476-5110112,5110196-5110439,5110519-5110917, 5111390-5111668,5111886-5112257,5112371-5112475, 5112832-5112909,5112990-5113199,5113287-5113406, 5113508-5113606,5113685-5113750,5113914-5114141, 5114216-5114521,5115324-5115381 Length = 1066 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/62 (25%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +3 Query: 687 ESPXPREKAVXXLXALPXPXPXTPXPRPFGCGE---PXXPXQRRXXRLSPXSGXTPXKNX 857 ++P P L + P P RP G G P P QR + P + P ++ Sbjct: 167 QAPAPSVARNPNLPIVQPPSVNNPPSRPIGSGNGVPPYPPPQRSLPAIPPSTSGVPRESV 226 Query: 858 XP 863 P Sbjct: 227 KP 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,063,705 Number of Sequences: 37544 Number of extensions: 354016 Number of successful extensions: 940 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -