BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G06 (896 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 117 9e-27 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 117 1e-26 At3g48080.1 68416.m05242 lipase class 3 family protein / disease... 29 5.5 At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family... 28 9.7 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 117 bits (282), Expect = 9e-27 Identities = 49/83 (59%), Positives = 64/83 (77%) Frame = +2 Query: 101 KRLELLGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 280 K++ ++GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C + A Sbjct: 6 KKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDCGKVKA 65 Query: 281 GGAWVFSTTAASSCRSAVRRLRE 349 GGA+ +T +A + RS +RRLRE Sbjct: 66 GGAYTMNTASAVTVRSTIRRLRE 88 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 117 bits (281), Expect = 1e-26 Identities = 50/83 (60%), Positives = 63/83 (75%) Frame = +2 Query: 101 KRLELLGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 280 K+ ++GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C + A Sbjct: 6 KKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDCGKVKA 65 Query: 281 GGAWVFSTTAASSCRSAVRRLRE 349 GGA+ +T +A + RS +RRLRE Sbjct: 66 GGAYTMNTASAVTVRSTIRRLRE 88 >At3g48080.1 68416.m05242 lipase class 3 family protein / disease resistance protein-related similar to disease resistance protein/lipase homolog EDS1 GI:4454567; contains Pfam profile PF01764: Lipase Length = 629 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 72 EVYQNGQTYQKGWNYLANMAHVTVPLY 152 E++ G T++K WN L + + PLY Sbjct: 591 EIFLEGSTFRKWWNTLPDSHKIHAPLY 617 >At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family protein Length = 660 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 681 INESPXPREKAVXXLXALPXPXPXTPXPRP 770 IN +P PR +L P TP PRP Sbjct: 558 INSTPHPRPSVTSKAISLQSPPCNTPQPRP 587 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,094,423 Number of Sequences: 28952 Number of extensions: 282532 Number of successful extensions: 787 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -