BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G05 (893 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 24 5.4 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 7.2 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 24 7.2 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = -1 Query: 764 PEPHGGW-GVXEXXRYGGNXPA 702 P PHGGW GV + + P+ Sbjct: 66 PRPHGGWQGVKDGSEHRSTCPS 87 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 554 AIVSGKYDAVVTESFFNDAEAGYGAVLQVPWILLSSVSI 670 +IV AVV F GYG V +P ++++ I Sbjct: 297 SIVGAVSPAVVVPRLFRLRTKGYGVVKGIPTLIIAVAGI 335 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.8 bits (49), Expect = 7.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 545 LQQAIVSGKYDAVVT 589 LQ A+++G YD +VT Sbjct: 263 LQAAVIAGSYDEIVT 277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,600 Number of Sequences: 2352 Number of extensions: 14947 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96334083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -