BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_G02 (834 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 107 4e-25 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 3.8 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 24 6.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 6.6 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 107 bits (257), Expect = 4e-25 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (0%) Frame = +1 Query: 199 EVVSVPEGC-TTKSKHGDMLTMHYTGTLDDGHKFDSSYDRDQPFTFQIGVGQVIKGWDQG 375 ++V + G TT K G +HYTGTLDDG FDSS R +PF F +G G+VI+GWD+G Sbjct: 4 QIVPIANGDQTTFPKPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGWDEG 63 Query: 376 LLDMCVGEKRKLTIPASLGYGERGAGNVIPPHATLHFEVELINI 507 + M VG++ KL YG RG VIPP+A L F+VEL+ + Sbjct: 64 VAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNARLTFDVELLRV 107 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.6 bits (51), Expect = 3.8 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -1 Query: 678 NKFIVTFQHLLDVFAYFTTVGGNHLLLQIVAH-FFAGEHVVLIGVDFLEHVCGRWRVTDV 502 NKF FQ+L+D + + N L I+ F G +G + + G W VT Sbjct: 371 NKFTRGFQNLIDAYGIASYREANPALYTIITFPFLFGIMFGDLGHGMIMALFGLWMVTGE 430 Query: 501 DQL 493 +L Sbjct: 431 KKL 433 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.8 bits (49), Expect = 6.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 662 VTINLLRKSSSHEDKDKNGFISHEEFSGPKHXEL 763 VT+ LL+++ DK + G FSG K +L Sbjct: 277 VTVELLQEAKEGADKFRQGIGRGGSFSGIKERKL 310 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 6.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 502 NIGDSPPATNVFKEIDADKDNMLSR 576 N+G PP ++ +D D+D ++ R Sbjct: 339 NMGGGPPPSSATPSVDDDEDVVIGR 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,049 Number of Sequences: 2352 Number of extensions: 17095 Number of successful extensions: 60 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -