BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F22 (873 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16640.1 68417.m02515 matrix metalloproteinase, putative meta... 28 7.1 >At4g16640.1 68417.m02515 matrix metalloproteinase, putative metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 364 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 267 VSFDFTPQFSTTKLKTGLFGLKNGAEIPFDAL 362 VSF+ F+T LK G + +G +PFD + Sbjct: 199 VSFEEVDDFTTADLKIGFYAGDHGDGLPFDGV 230 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,870,140 Number of Sequences: 28952 Number of extensions: 268884 Number of successful extensions: 536 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -