BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F19 (901 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X51630-1|CAA35956.1| 575|Homo sapiens Krueppel-like zinc-finge... 28 0.31 AL049692-3|CAI95759.2| 517|Homo sapiens Wilms tumor 1 protein. 28 0.31 AL049692-4|CAI95758.2| 500|Homo sapiens Wilms tumor 1 protein. 28 0.31 AL049692-2|CAC39220.2| 497|Homo sapiens Wilms tumor 1 protein. 28 0.31 M80232-1|AAA61299.1| 449|Homo sapiens Wilms' tumor assocated pr... 28 0.31 AY245105-1|AAO61088.1| 449|Homo sapiens Wilms tumor 1 protein. 28 0.31 X61631-1|CAA43819.1| 446|Homo sapiens protein ( H.sapiens Wilms... 28 0.31 BC046461-1|AAH46461.2| 331|Homo sapiens WT1 protein protein. 28 0.32 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 35 0.46 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 35 0.46 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 35 0.46 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 35 0.46 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 35 0.46 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 35 0.46 AB209887-1|BAD93124.1| 725|Homo sapiens WD repeat domain 26 var... 35 0.46 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 35 0.46 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 35 0.46 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 34 0.61 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 34 0.61 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 34 0.61 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 34 0.61 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 34 0.61 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 33 0.68 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 34 0.81 AY476736-1|AAS58324.1| 244|Homo sapiens heparan sulfate 3-O-sul... 34 0.81 AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sul... 34 0.81 AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. 27 0.85 AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. 27 0.85 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 33 1.1 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 33 1.1 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 33 1.1 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 33 1.1 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 33 1.4 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 33 1.4 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 33 1.4 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 33 1.4 U66559-1|AAC51104.1| 1620|Homo sapiens anaplastic lymphoma kinas... 33 1.4 U62540-1|AAB71619.1| 1620|Homo sapiens anaplastic lymphoma kinas... 33 1.4 D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 33 1.4 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 33 1.4 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 33 1.4 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 33 1.4 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 33 1.4 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 33 1.4 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 33 1.4 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 33 1.4 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 33 1.4 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 33 1.4 AC074096-1|AAY15027.1| 1192|Homo sapiens unknown protein. 33 1.4 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 33 1.4 AB209477-1|BAD92714.1| 1626|Homo sapiens anaplastic lymphoma kin... 33 1.4 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 33 1.4 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 27 1.4 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 33 1.9 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 33 1.9 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 33 1.9 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 33 1.9 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 33 1.9 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 33 1.9 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 33 1.9 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 33 1.9 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 33 1.9 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 33 1.9 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 33 1.9 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 33 1.9 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 33 1.9 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 33 1.9 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 33 1.9 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 33 1.9 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 33 1.9 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 33 1.9 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 33 1.9 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 32 2.5 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 32 2.5 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 32 2.5 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 32 2.5 X58430-1|CAB86198.1| 496|Homo sapiens homeobox protein protein. 32 2.5 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 32 2.5 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 32 2.5 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 32 2.5 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 32 2.5 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 32 2.5 BC013971-1|AAH13971.1| 393|Homo sapiens homeobox A10 protein. 32 2.5 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 32 2.5 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 32 2.5 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 32 2.5 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 32 2.5 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 32 2.5 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 32 2.5 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 32 2.5 AF040714-1|AAB96917.1| 393|Homo sapiens homeobox protein A10 pr... 32 2.5 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 32 2.5 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 32 3.3 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 32 3.3 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 32 3.3 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 32 3.3 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 32 3.3 BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. 32 3.3 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 32 3.3 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 32 3.3 BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. 32 3.3 BC002767-1|AAH02767.1| 690|Homo sapiens LATS1 protein protein. 32 3.3 AF164041-1|AAD50272.1| 1130|Homo sapiens WARTS protein kinase pr... 32 3.3 AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP lik... 32 3.3 AF104413-1|AAD16882.1| 1130|Homo sapiens large tumor suppressor ... 32 3.3 AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. 32 3.3 AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. 32 3.3 AB209426-1|BAD92663.1| 830|Homo sapiens LATS homolog 1 variant ... 32 3.3 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 32 3.3 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 26 3.3 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 26 3.3 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 26 3.3 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 26 3.3 U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. 31 4.3 L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcrip... 31 4.3 K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary ... 31 4.3 BC033084-1|AAH33084.1| 1164|Homo sapiens formin homology 2 domai... 31 4.3 AY192154-1|AAO38757.1| 1164|Homo sapiens FHOS protein. 31 4.3 AL833083-1|CAD89973.1| 1067|Homo sapiens hypothetical protein pr... 31 4.3 AL590999-1|CAI16176.2| 1068|Homo sapiens dishevelled associated ... 31 4.3 AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, tr... 31 4.3 AL357412-1|CAI23288.2| 1068|Homo sapiens dishevelled associated ... 31 4.3 AL136089-1|CAI20010.2| 1068|Homo sapiens dishevelled associated ... 31 4.3 AF113615-1|AAD39906.1| 1164|Homo sapiens FH1/FH2 domain-containi... 31 4.3 AB209584-1|BAD92821.1| 1017|Homo sapiens P127 variant protein. 31 4.3 AB041046-1|BAD06250.1| 1164|Homo sapiens p127 protein. 31 4.3 AB002379-1|BAA20835.2| 1114|Homo sapiens KIAA0381 protein protein. 31 4.3 BX537888-1|CAD97884.1| 500|Homo sapiens hypothetical protein pr... 31 4.3 BC018135-1|AAH18135.1| 471|Homo sapiens pre-mRNA cleavage facto... 31 4.3 AJ275970-1|CAC81661.1| 471|Homo sapiens pre-mRNA cleavage facto... 31 4.3 AK022591-1|BAB14118.1| 237|Homo sapiens protein ( Homo sapiens ... 31 4.6 AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. 25 5.4 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 31 5.7 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 31 5.7 X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. 31 5.7 X52979-2|CAA37171.1| 32|Homo sapiens SmB' protein protein. 31 5.7 X17568-1|CAB57868.1| 240|Homo sapiens snRNP B' protein protein. 31 5.7 M34082-1|AAA36579.1| 233|Homo sapiens protein ( Human small nuc... 31 5.7 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 31 5.7 J04564-1|AAA60151.1| 285|Homo sapiens SNRPB protein. 31 5.7 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 31 5.7 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 31 5.7 CR533459-1|CAG38490.1| 148|Homo sapiens DKFZP564J157 protein. 31 5.7 CR456969-1|CAG33250.1| 240|Homo sapiens SNRPB protein. 31 5.7 BC066943-1|AAH66943.1| 148|Homo sapiens proline rich 13 protein. 31 5.7 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 31 5.7 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 31 5.7 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 31 5.7 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 31 5.7 BC016064-1|AAH16064.1| 148|Homo sapiens proline rich 13 protein. 31 5.7 BC014257-1|AAH14257.1| 148|Homo sapiens proline rich 13 protein. 31 5.7 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 31 5.7 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 31 5.7 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 31 5.7 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 31 5.7 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 31 5.7 AL049650-8|CAB46715.1| 240|Homo sapiens small nuclear ribonucle... 31 5.7 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 31 5.7 AK024089-1|BAB14822.1| 593|Homo sapiens protein ( Homo sapiens ... 31 5.7 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 31 5.7 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 31 5.7 AF134825-1|AAD54489.1| 243|Homo sapiens small nuclear ribonucle... 31 5.7 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 31 5.7 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 31 5.7 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 31 5.7 BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, au... 25 5.8 AL031668-5|CAI22150.1| 306|Homo sapiens RNA binding protein, au... 25 5.8 AF148457-1|AAF04487.1| 306|Homo sapiens heterogeneous nuclear r... 25 5.8 AL031668-6|CAB43742.1| 290|Homo sapiens RNA binding protein, au... 25 5.9 AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant pr... 26 7.0 AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 7.0 AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 7.0 AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 7.0 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 27 7.0 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 27 7.0 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 27 7.2 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 27 7.2 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 27 7.2 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 27 7.2 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 27 7.2 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 27 7.3 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 27 7.3 BC022464-1|AAH22464.1| 459|Homo sapiens FEZ family zinc finger ... 25 7.3 X52282-1|CAA36523.1| 540|Homo sapiens precursor protein (AA -18... 31 7.5 X16163-1|CAA34288.1| 218|Homo sapiens SmB /B' autoimmune antige... 31 7.5 X15892-1|CAA33901.1| 240|Homo sapiens protein ( Human hcerN3 ge... 31 7.5 X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 p... 31 7.5 X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. 31 7.5 U87166-1|AAC39757.1| 508|Homo sapiens spectrin SH3 domain bindi... 31 7.5 U41303-1|AAA98969.1| 240|Homo sapiens small nuclear ribonuleopr... 31 7.5 S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. 31 7.5 S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. 31 7.5 M93119-1|AAA58680.1| 510|Homo sapiens IA-1 protein. 31 7.5 M59305-1|AAA51734.1| 541|Homo sapiens atrial natriuretic peptid... 31 7.5 L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiester... 31 7.5 K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. 31 7.5 J04615-1|AAA36617.1| 240|Homo sapiens protein ( Human lupus aut... 31 7.5 CR450350-1|CAG29346.1| 240|Homo sapiens SNRPN protein. 31 7.5 BC131540-1|AAI31541.1| 541|Homo sapiens natriuretic peptide rec... 31 7.5 BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. 31 7.5 BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. 31 7.5 BC121793-1|AAI21794.1| 837|Homo sapiens family with sequence si... 31 7.5 BC119814-1|AAI19815.1| 837|Homo sapiens family with sequence si... 31 7.5 BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. 31 7.5 BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. 31 7.5 BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. 31 7.5 BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. 31 7.5 BC094786-1|AAH94786.1| 837|Homo sapiens family with sequence si... 31 7.5 BC025178-1|AAH25178.1| 240|Homo sapiens small nuclear ribonucle... 31 7.5 BC024777-1|AAH24777.1| 240|Homo sapiens SNURF protein protein. 31 7.5 BC020238-1|AAH20238.1| 596|Homo sapiens SRP68 protein protein. 31 7.5 BC003180-1|AAH03180.1| 240|Homo sapiens small nuclear ribonucle... 31 7.5 BC000611-1|AAH00611.1| 240|Homo sapiens SNRPN protein protein. 31 7.5 AL772411-3|CAH70967.1| 837|Homo sapiens family with sequence si... 31 7.5 AL161658-1|CAC36065.1| 510|Homo sapiens insulinoma-associated 1... 31 7.5 AL160006-2|CAI22715.1| 837|Homo sapiens family with sequence si... 31 7.5 AL121749-3|CAC10185.1| 694|Homo sapiens frizzled homolog 8 (Dro... 31 7.5 AK222633-1|BAD96353.1| 240|Homo sapiens small nuclear ribonucle... 31 7.5 AK074698-1|BAC11145.1| 627|Homo sapiens protein ( Homo sapiens ... 31 7.5 AF540955-1|AAN28379.1| 476|Homo sapiens Abl-interactor 1 protein. 31 7.5 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 31 7.5 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 31 7.5 AF400432-1|AAK92481.1| 240|Homo sapiens small nuclear ribonucle... 31 7.5 AF195951-1|AAF24308.1| 619|Homo sapiens signal recognition part... 31 7.5 AF134832-1|AAD54487.1| 47|Homo sapiens small nuclear ribonucle... 31 7.5 AF025998-1|AAB88801.1| 540|Homo sapiens atrial natriuretic pept... 31 7.5 AB101582-1|BAC56126.1| 540|Homo sapiens natriuretic peptide rec... 31 7.5 AB051548-1|BAB21852.2| 837|Homo sapiens KIAA1761 protein protein. 31 7.5 AB043703-1|BAB41064.1| 694|Homo sapiens seven-transmembrane rec... 31 7.5 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 31 7.5 AK001004-1|BAA91464.1| 304|Homo sapiens protein ( Homo sapiens ... 25 7.6 BC033513-1|AAH33513.1| 265|Homo sapiens Unknown (protein for IM... 26 7.7 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 30 9.1 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 25 9.1 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 30 9.1 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 30 10.0 X78202-1|CAA55038.1| 469|Homo sapiens HBF-G2 (HFK-2) protein. 30 10.0 X74143-1|CAA52240.1| 469|Homo sapiens transcription factor prot... 30 10.0 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 30 10.0 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 30 10.0 X07517-1|CAA30395.2| 236|Homo sapiens salivary proline-rich pro... 30 10.0 X07516-1|CAA30394.2| 297|Homo sapiens salivary proline-rich pro... 30 10.0 X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for ... 30 10.0 S62941-1|AAB27289.1| 358|Homo sapiens Ps 2 protein. 30 10.0 S62928-1|AAB27288.2| 297|Homo sapiens PRB1M protein precursor p... 30 10.0 S52986-1|AAA13341.2| 331|Homo sapiens basic salivary proline-ri... 30 10.0 M97220-1|AAB05816.1| 331|Homo sapiens salivary proline-rich pro... 30 10.0 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 30 10.0 M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-a... 30 10.0 K03204-1|AAA60185.1| 331|Homo sapiens PRB1 protein. 30 10.0 CR542039-1|CAG46836.1| 253|Homo sapiens PRNP protein. 30 10.0 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 30 10.0 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 30 10.0 BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 30 10.0 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 30 10.0 BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. 30 10.0 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 30 10.0 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 30 10.0 BC044827-1|AAH44827.1| 338|Homo sapiens PRB2 protein protein. 30 10.0 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 30 10.0 BC034498-1|AAH34498.1| 209|Homo sapiens WDR26 protein protein. 30 10.0 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 30 10.0 BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 30 10.0 BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 30 10.0 BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. 30 10.0 BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 30 10.0 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 30 10.0 AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit ... 30 10.0 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 30 10.0 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 30 10.0 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 30 10.0 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 30 10.0 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 30 10.0 AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens ... 30 10.0 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 30 10.0 AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent prote... 30 10.0 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 30 10.0 AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. 30 10.0 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 30 10.0 AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho... 30 10.0 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 30 10.0 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 30 10.0 AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. 30 10.0 >X51630-1|CAA35956.1| 575|Homo sapiens Krueppel-like zinc-finger protein protein. Length = 575 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 187 PPPPPPPPHSF 197 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 175 GSLGGPAPPPAPPPPP 190 >AL049692-3|CAI95759.2| 517|Homo sapiens Wilms tumor 1 protein. Length = 517 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 129 PPPPPPPPHSF 139 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 117 GSLGGPAPPPAPPPPP 132 >AL049692-4|CAI95758.2| 500|Homo sapiens Wilms tumor 1 protein. Length = 500 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 129 PPPPPPPPHSF 139 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 117 GSLGGPAPPPAPPPPP 132 >AL049692-2|CAC39220.2| 497|Homo sapiens Wilms tumor 1 protein. Length = 497 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 129 PPPPPPPPHSF 139 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 117 GSLGGPAPPPAPPPPP 132 >M80232-1|AAA61299.1| 449|Homo sapiens Wilms' tumor assocated protein protein. Length = 449 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 61 PPPPPPPPHSF 71 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 49 GSLGGPAPPPAPPPPP 64 >AY245105-1|AAO61088.1| 449|Homo sapiens Wilms tumor 1 protein. Length = 449 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 61 PPPPPPPPHSF 71 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 49 GSLGGPAPPPAPPPPP 64 >X61631-1|CAA43819.1| 446|Homo sapiens protein ( H.sapiens Wilms tumor gene 1, exon 1. ). Length = 446 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 61 PPPPPPPPHSF 71 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 49 GSLGGPAPPPAPPPPP 64 >BC046461-1|AAH46461.2| 331|Homo sapiens WT1 protein protein. Length = 331 Score = 28.3 bits (60), Expect(2) = 0.32 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP F Sbjct: 143 PPPPPPPPHSF 153 Score = 25.8 bits (54), Expect(2) = 0.32 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 724 GGXGXGXXPPPPPPPP 771 G G PP PPPPP Sbjct: 131 GSLGGPAPPPAPPPPP 146 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 34.7 bits (76), Expect = 0.46 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 373 PPPPPPPPPPPGPPPPPG 390 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP PPPP + APP Sbjct: 287 PPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPP 323 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKK 397 PP PPPPPP PPP K K+ Sbjct: 1473 PPPLPPPPPPPLPPPPPLPKTPRGGKR 1499 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1466 PPLPPPPPPPLPPPPPP 1482 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 34.7 bits (76), Expect = 0.46 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 373 PPPPPPPPPPPGPPPPPG 390 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP PPPP + APP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPP 323 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 34.7 bits (76), Expect = 0.46 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 373 PPPPPPPPPPPGPPPPPG 390 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP PPPP + APP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPP 323 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 34.7 bits (76), Expect = 0.46 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 88 PPPPPPPPPPPPLPPPPG 105 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 34.7 bits (76), Expect = 0.46 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 373 PPPPPPPPPPPGPPPPPG 390 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP PPPP + APP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPP 323 >AB209887-1|BAD93124.1| 725|Homo sapiens WD repeat domain 26 variant protein. Length = 725 Score = 34.7 bits (76), Expect = 0.46 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 428 GGGXXXXGGGGGGXXGGXKKKKTPXLXFIXKKN 526 GGG GGGGGG GG + +TP L + +N Sbjct: 71 GGGGGGGGGGGGGGGGGGGQGQTPELACLSAQN 103 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKK 397 PP PPPPPP PPP K K+ Sbjct: 1473 PPPLPPPPPPPLPPPPPLPKTPRGGKR 1499 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1466 PPLPPPPPPPLPPPPPP 1482 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 34.7 bits (76), Expect = 0.46 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKK 397 PP PPPPPP PPP K K+ Sbjct: 1536 PPPLPPPPPPPLPPPPPLPKTPRGGKR 1562 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1529 PPLPPPPPPPLPPPPPP 1545 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 34.3 bits (75), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 486 FXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 316 FAPPPAPPPPPPPMIGIPPP 335 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPP 429 PP PPPPP G PPP Sbjct: 391 PPPPPPPPPPGPPPPP 406 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 34.3 bits (75), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 486 FXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 316 FAPPPAPPPPPPPMIGIPPP 335 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPP 429 PP PPPPP G PPP Sbjct: 391 PPPPPPPPPPGPPPPP 406 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 34.3 bits (75), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 486 FXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 444 FAPPPAPPPPPPPMIGIPPP 463 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 34.3 bits (75), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 486 FXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 315 FAPPPAPPPPPPPMIGIPPP 334 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 34.3 bits (75), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 486 FXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 316 FAPPPAPPPPPPPMIGIPPP 335 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPP 429 PP PPPPP G PPP Sbjct: 391 PPPPPPPPPPGPPPPP 406 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 489 FFXXPPXXPPPPPPXXXXPPP 427 F PP PPPPPP PPP Sbjct: 65 FAALPPPPPPPPPPPPQQPPP 85 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 70 PPPPPPPPPPPQQPPPP 86 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 71 PPPPPPPPPPQQPPPPP 87 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 72 PPPPPPPPPQQPPPPPP 88 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 604 PP--PPPPPSGQPPPPP 618 Score = 27.9 bits (59), Expect(2) = 0.68 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPPP + PPP Sbjct: 83 PPPPPPPPSPGASYPPPQPPP 103 Score = 25.0 bits (52), Expect(2) = 0.68 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 726 GGGXGXXXPPPPPPP 770 G G G P PPPPP Sbjct: 37 GPGAGLLAPGPPPPP 51 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 33.9 bits (74), Expect = 0.81 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXK 418 PP PPPPPP PPP K Sbjct: 311 PPPPPPPPPPRPVLPPPAPK 330 >AY476736-1|AAS58324.1| 244|Homo sapiens heparan sulfate 3-O-sulfotransferase-4 protein. Length = 244 Score = 33.9 bits (74), Expect = 0.81 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 7 PPPPPPPPPPLAAPPPPG 24 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP PPPPP PPP K +K Sbjct: 8 PPPPPPPPPLAAPPPPGASAKGPPARK 34 >AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sulfotransferase-4 protein. Length = 456 Score = 33.9 bits (74), Expect = 0.81 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 7 PPPPPPPPPPLAAPPPPG 24 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP PPPPP PPP K +K Sbjct: 8 PPPPPPPPPLAAPPPPGASAKGPPARK 34 >AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. Length = 1183 Score = 27.1 bits (57), Expect(2) = 0.85 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP + Sbjct: 220 PPPPPPPPPHY 230 Score = 25.4 bits (53), Expect(2) = 0.85 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 219 GPPPPPPPPP 228 >AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. Length = 1111 Score = 27.1 bits (57), Expect(2) = 0.85 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP + Sbjct: 179 PPPPPPPPPHY 189 Score = 25.4 bits (53), Expect(2) = 0.85 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 178 GPPPPPPPPP 187 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPPP PPP K Sbjct: 246 PPPPPPPPPPAPKMPPPEKTK 266 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKK 414 PP PPPPP PPP KK Sbjct: 247 PPPPPPPPPAPKMPPPEKTKK 267 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPP 426 P PPPPP PPPP Sbjct: 49 PPPPPPPPESPPPPPP 64 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXK 418 PP PPPPPP PP K Sbjct: 245 PPPPPPPPPPPAPKMPPPEK 264 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPPP PPP K Sbjct: 907 PPPPPPPPPPAPKMPPPEKTK 927 Score = 32.3 bits (70), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 464 PPPPPXGXXPPPPGXKKXXXXKKXGGXKXXA 372 PPPPP PPPP K K G K A Sbjct: 904 PPPPPPPPPPPPPAPKMPPPEKTKKGRKDKA 934 Score = 32.3 bits (70), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXK 399 PP PPPPP PPP KK K Sbjct: 908 PPPPPPPPPAPKMPPPEKTKKGRKDK 933 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPP 426 P PPPPP PPPP Sbjct: 710 PPPPPPPPESPPPPPP 725 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXK 418 PP PPPPPP PP K Sbjct: 906 PPPPPPPPPPPAPKMPPPEK 925 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPPP PPP K Sbjct: 452 PPPPPPPPPPAPKMPPPEKTK 472 Score = 32.3 bits (70), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 464 PPPPPXGXXPPPPGXKKXXXXKKXGGXKXXA 372 PPPPP PPPP K K G K A Sbjct: 449 PPPPPPPPPPPPPAPKMPPPEKTKKGRKDKA 479 Score = 32.3 bits (70), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXK 399 PP PPPPP PPP KK K Sbjct: 453 PPPPPPPPPAPKMPPPEKTKKGRKDK 478 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPP 426 P PPPPP PPPP Sbjct: 255 PPPPPPPPESPPPPPP 270 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXK 418 PP PPPPPP PP K Sbjct: 451 PPPPPPPPPPPAPKMPPPEK 470 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 33.5 bits (73), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPPP PPP K Sbjct: 942 PPPPPPPPPPAPKMPPPEKTK 962 Score = 32.3 bits (70), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 464 PPPPPXGXXPPPPGXKKXXXXKKXGGXKXXA 372 PPPPP PPPP K K G K A Sbjct: 939 PPPPPPPPPPPPPAPKMPPPEKTKKGRKDKA 969 Score = 32.3 bits (70), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXK 399 PP PPPPP PPP KK K Sbjct: 943 PPPPPPPPPAPKMPPPEKTKKGRKDK 968 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPP 426 P PPPPP PPPP Sbjct: 745 PPPPPPPPESPPPPPP 760 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXK 418 PP PPPPPP PP K Sbjct: 941 PPPPPPPPPPPAPKMPPPEK 960 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >U66559-1|AAC51104.1| 1620|Homo sapiens anaplastic lymphoma kinase receptor protein. Length = 1620 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 418 FXPGGGGXXPXGGGGGXXGGXXKKKNXP 501 F GGGG GGGGG GG N P Sbjct: 921 FGGGGGGCSSGGGGGGYIGGNAASNNDP 948 >U62540-1|AAB71619.1| 1620|Homo sapiens anaplastic lymphoma kinase protein. Length = 1620 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 418 FXPGGGGXXPXGGGGGXXGGXXKKKNXP 501 F GGGG GGGGG GG N P Sbjct: 921 FGGGGGGCSSGGGGGGYIGGNAASNNDP 948 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 498 GVFFFXXPPXXPPPPPPXXXXPPP 427 G PP PPPPPP PPP Sbjct: 457 GYIMTAAPPPHPPPPPPPPPPPPP 480 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 489 FFXXPPXXPPPPPPXXXXPPP 427 + PP PPPPPP PPP Sbjct: 174 YLTQPPPPPPPPPPLPPPPPP 194 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 185 PPPLPPPPPPQPPPPPP 201 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 489 FFXXPPXXPPPPPPXXXXPPP 427 + PP PPPPPP PPP Sbjct: 174 YLTQPPPPPPPPPPLPPPPPP 194 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 185 PPPLPPPPPPQPPPPPP 201 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 611 PPPPPLGGVPPPPG 624 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 489 FFXXPPXXPPPPPPXXXXPPP 427 + PP PPPPPP PPP Sbjct: 115 YLTQPPPPPPPPPPLPPPPPP 135 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 126 PPPLPPPPPPQPPPPPP 142 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 498 GVFFFXXPPXXPPPPPPXXXXPPP 427 G PP PPPPPP PPP Sbjct: 582 GYIMTAAPPPHPPPPPPPPPPPPP 605 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 489 FFXXPPXXPPPPPPXXXXPPP 427 + PP PPPPPP PPP Sbjct: 174 YLTQPPPPPPPPPPLPPPPPP 194 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 185 PPPLPPPPPPQPPPPPP 201 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 464 PPPPPXGXXPPPPG 423 PPPPP G PPPPG Sbjct: 604 PPPPPLGGVPPPPG 617 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 658 PPPPPPPPPLALPPPPP 674 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 656 PPPPPPPPPPPLALPPP 672 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 657 PPPPPPPPPPLALPPPP 673 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 340 PPPPPPPPPLALPPPPP 356 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 338 PPPPPPPPPPPLALPPP 354 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 339 PPPPPPPPPPLALPPPP 355 >AC074096-1|AAY15027.1| 1192|Homo sapiens unknown protein. Length = 1192 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 418 FXPGGGGXXPXGGGGGXXGGXXKKKNXP 501 F GGGG GGGGG GG N P Sbjct: 493 FGGGGGGCSSGGGGGGYIGGNAASNNDP 520 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 498 GVFFFXXPPXXPPPPPPXXXXPPP 427 G PP PPPPPP PPP Sbjct: 582 GYIMTAAPPPHPPPPPPPPPPPPP 605 >AB209477-1|BAD92714.1| 1626|Homo sapiens anaplastic lymphoma kinase Ki-1 variant protein. Length = 1626 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 418 FXPGGGGXXPXGGGGGXXGGXXKKKNXP 501 F GGGG GGGGG GG N P Sbjct: 927 FGGGGGGCSSGGGGGGYIGGNAASNNDP 954 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 33.1 bits (72), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 1424 PPPPPPPPPLALPPPPP 1440 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1422 PPPPPPPPPPPLALPPP 1438 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1423 PPPPPPPPPPLALPPPP 1439 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 27.1 bits (57), Expect(2) = 1.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPPP + PPP Sbjct: 603 PPPPPPPPPLPGGTAISPPPP 623 Score = 24.6 bits (51), Expect(2) = 1.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 732 GXGXXXPPPPPPP 770 G PPPPPPP Sbjct: 594 GDSTTPPPPPPPP 606 >L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease protein protein. Length = 3144 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 42 PPPPPPPPPPQLPQPPP 58 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 134 PPPLPPPPPPAMPSPPP 150 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 135 PPLPPPPPPAMPSPPPP 151 >BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IMAGE:3946309) protein. Length = 39 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 17 PPLRPPPPPPPLPPPPP 33 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 626 PPLPPPPPPPPPPPPPP 642 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPP 645 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPP 646 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPP 647 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPP 648 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1993 PPPTPPPPPPPPPPPPP 2009 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1994 PPTPPPPPPPPPPPPPP 2010 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1997 PPPPPPPPPPPPPPPPP 2013 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1998 PPPPPPPPPPPPPPPPP 2014 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1999 PPPPPPPPPPPPPPPPP 2015 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 2000 PPPPPPPPPPPPPPPPP 2016 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 466 PPMPPPPPPPPPPPPPP 482 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPP 485 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPP 486 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPP 487 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPP 488 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPP 489 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPP 490 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PP PG Sbjct: 476 PPPPPPPPPPPPPPPLPG 493 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPP 935 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 920 PPPPPPPPPPPPPPPPP 936 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 921 PPPPPPPPPPPPPPPPP 937 Score = 32.7 bits (71), Expect = 1.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPPP PPPP G PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPP 958 Score = 25.0 bits (52), Expect(2) = 5.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPP L PPP Sbjct: 940 PPPPPPALDVGETSNLQPPPP 960 Score = 24.6 bits (51), Expect(2) = 5.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 732 GXGXXXPPPPPPP 770 G PPPPPPP Sbjct: 915 GASLPPPPPPPPP 927 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPP 935 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 920 PPPPPPPPPPPPPPPPP 936 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 921 PPPPPPPPPPPPPPPPP 937 Score = 32.7 bits (71), Expect = 1.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPPP PPPP G PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPP 958 Score = 25.0 bits (52), Expect(2) = 5.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPP L PPP Sbjct: 940 PPPPPPALDVGETSNLQPPPP 960 Score = 24.6 bits (51), Expect(2) = 5.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 732 GXGXXXPPPPPPP 770 G PPPPPPP Sbjct: 915 GASLPPPPPPPPP 927 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPP 81 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPP 82 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPP 83 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPP 84 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 454 PPTPPPPPPPPPPPPPP 470 >AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ14966 fis, clone THYRO1000034, weakly similar to TRICHOHYALIN. ). Length = 509 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 268 PPPPPPPPPPPPPPPPP 284 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 626 PPLPPPPPPPPPPPPPP 642 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPP 645 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPP 646 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPP 647 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPP 648 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 660 PPPPPPPPPPPPPPPPP 676 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 661 PPPPPPPPPPPPPPPPP 677 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 662 PPPPPPPPPPPPPPPPP 678 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 663 PPPPPPPPPPPPPPPPP 679 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 569 PPMPPPPPPPPPPPPPP 585 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPP 588 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPP 589 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPP 590 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPP 591 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPP 592 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPP 593 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PP PG Sbjct: 579 PPPPPPPPPPPPPPPLPG 596 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 612 PPLPPPPPPPPPPPPPP 628 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPP 631 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPP 632 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPP 633 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPP 634 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 679 PPPLPPPPPPAMPSPPP 695 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 680 PPLPPPPPPAMPSPPPP 696 >AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. Length = 3144 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 42 PPPPPPPPPPQLPQPPP 58 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 1413 PPPPPPPPPPQQPLPPP 1429 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 1414 PPPPPPPPPQQPLPPPP 1430 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 32.7 bits (71), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPP 427 PP PPPPPP PPP Sbjct: 602 PPQQPPPPPPPPPPPPP 618 Score = 27.1 bits (57), Expect(2) = 8.6 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 748 PPPPPPPPXXF 780 PPPPPPPP + Sbjct: 609 PPPPPPPPPPY 619 Score = 21.8 bits (44), Expect(2) = 8.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G PPP P PP Sbjct: 593 GGSPPPAPTPP 603 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP G PPPPG G APP Sbjct: 305 PPPGPPPPQQG-PPPPPGPFPPRPPGPLGPPLTLAPP 340 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PP PP PPPPG Sbjct: 239 PPLGPPGPPGPPGPPPPG 256 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP G PPPPG G APP Sbjct: 305 PPPGPPPPQQG-PPPPPGPFPPRPPGPLGPPLTLAPP 340 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PP PP PPPPG Sbjct: 239 PPLGPPGPPGPPGPPPPG 256 >X58430-1|CAB86198.1| 496|Homo sapiens homeobox protein protein. Length = 496 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 215 PPDGPPPPPQQQPPPPP 231 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >BC013971-1|AAH13971.1| 393|Homo sapiens homeobox A10 protein. Length = 393 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 112 PPDGPPPPPQQQPPPPP 128 >BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. Length = 478 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP G PPPPG G APP Sbjct: 232 PPPGPPPPQQG-PPPPPGPFPPRPPGPLGPPLTLAPP 267 >BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. Length = 588 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP G PPPPG G APP Sbjct: 342 PPPGPPPPQQG-PPPPPGPFPPRPPGPLGPPLTLAPP 377 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PP PP PPPPG Sbjct: 276 PPLGPPGPPGPPGPPPPG 293 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 161 PPPPPPPPPSPLPPPPP 177 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 32.3 bits (70), Expect = 2.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP PPPP G PPPPG G APP Sbjct: 305 PPPGPPPPQQG-PPPPPGPFPPRPPGPLGPPLTLAPP 340 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PP PP PPPPG Sbjct: 239 PPLGPPGPPGPPGPPPPG 256 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 45 PPPPPPPPPLPPPPPPP 61 >AF040714-1|AAB96917.1| 393|Homo sapiens homeobox protein A10 protein. Length = 393 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 112 PPDGPPPPPQQQPPPPP 128 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 32.3 bits (70), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP PPPP Sbjct: 955 PPPPPPPPPHPPLPPPP 971 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 31.9 bits (69), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP PPPPG G PP Sbjct: 170 PPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPP 206 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPP G PPPPG Sbjct: 165 PPAGGPPPPPG-PPPPPG 181 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 31.9 bits (69), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP PPPPG G PP Sbjct: 168 PPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPP 204 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPP G PPPPG Sbjct: 163 PPAGGPPPPPG-PPPPPG 179 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 31.9 bits (69), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP P PPP G PPPG KK Sbjct: 574 PPPPPGPPPLGAIMPPPGAPMGLALKK 600 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPP P G PPPP Sbjct: 550 PPPPPPPLPGGMLPPPP 566 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPG 423 P PPP P G PPPPG Sbjct: 563 PPPPPPLPPGGPPPPPG 579 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 31.9 bits (69), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP P PPP G PPPG KK Sbjct: 574 PPPPPGPPPLGAIMPPPGAPMGLALKK 600 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPP P G PPPP Sbjct: 550 PPPPPPPLPGGMLPPPP 566 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPG 423 P PPP P G PPPPG Sbjct: 563 PPPPPPLPPGGPPPPPG 579 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 31.9 bits (69), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP PPPPG G PP Sbjct: 170 PPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPP 206 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPP G PPPPG Sbjct: 165 PPAGGPPPPPG-PPPPPG 181 >BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. Length = 418 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 188 PPPPVPPPPTGATPPPP 204 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 31.9 bits (69), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP PPPPG G PP Sbjct: 171 PPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPP 207 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPP G PPPPG Sbjct: 166 PPAGGPPPPPG-PPPPPG 182 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 31.9 bits (69), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP P PPP G PPPG KK Sbjct: 168 PPPPPGPPPLGAIMPPPGAPMGLALKK 194 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPP P G PPPP Sbjct: 144 PPPPPPPLPGGMLPPPP 160 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPG 423 P PPP P G PPPPG Sbjct: 157 PPPPPPLPPGGPPPPPG 173 >BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. Length = 416 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 186 PPPPVPPPPTGATPPPP 202 >BC002767-1|AAH02767.1| 690|Homo sapiens LATS1 protein protein. Length = 690 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 PP PPP G PPPP + K+ G Sbjct: 250 PPRGQTPPPRGTTPPPPSWEPNSQTKRYSG 279 >AF164041-1|AAD50272.1| 1130|Homo sapiens WARTS protein kinase protein. Length = 1130 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 PP PPP G PPPP + K+ G Sbjct: 250 PPRGQTPPPRGTTPPPPSWEPNSQTKRYSG 279 >AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP like protein protein. Length = 362 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 132 PPPPVPPPPTGATPPPP 148 >AF104413-1|AAD16882.1| 1130|Homo sapiens large tumor suppressor 1 protein. Length = 1130 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 PP PPP G PPPP + K+ G Sbjct: 250 PPRGQTPPPRGTTPPPPSWEPNSQTKRYSG 279 >AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. Length = 418 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 188 PPPPVPPPPTGATPPPP 204 >AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. Length = 418 Score = 31.9 bits (69), Expect = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 188 PPPPVPPPPTGATPPPP 204 >AB209426-1|BAD92663.1| 830|Homo sapiens LATS homolog 1 variant protein. Length = 830 Score = 31.9 bits (69), Expect = 3.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 PP PPP G PPPP + K+ G Sbjct: 102 PPRGQTPPPRGTTPPPPSWEPNSQTKRYSG 131 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 31.9 bits (69), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKK 396 PP P PPP G PPPG KK Sbjct: 581 PPPPPGPPPLGAIMPPPGAPMGLALKK 607 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPP P G PPPP Sbjct: 557 PPPPPPPLPGGMLPPPP 573 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPG 423 P PPP P G PPPPG Sbjct: 570 PPPPPPLPPGGPPPPPG 586 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 25.8 bits (54), Expect(3) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 477 PPXXPPPPPP 448 PP PPPPPP Sbjct: 357 PPPVPPPPPP 366 Score = 21.8 bits (44), Expect(3) = 3.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 504 RXGVFFFXXPPXXPPPPP 451 R VF PP PPP P Sbjct: 323 RTPVFVSPTPPPPPPPLP 340 Score = 21.0 bits (42), Expect(3) = 3.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 474 PXXPPPPPPXXXXP 433 P PPPP P P Sbjct: 374 PAVPPPPAPLQIAP 387 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 25.8 bits (54), Expect(3) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 477 PPXXPPPPPP 448 PP PPPPPP Sbjct: 349 PPPVPPPPPP 358 Score = 21.8 bits (44), Expect(3) = 3.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 504 RXGVFFFXXPPXXPPPPP 451 R VF PP PPP P Sbjct: 315 RTPVFVSPTPPPPPPPLP 332 Score = 21.0 bits (42), Expect(3) = 3.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 474 PXXPPPPPPXXXXP 433 P PPPP P P Sbjct: 366 PAVPPPPAPLQIAP 379 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 25.8 bits (54), Expect(3) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 477 PPXXPPPPPP 448 PP PPPPPP Sbjct: 349 PPPVPPPPPP 358 Score = 21.8 bits (44), Expect(3) = 3.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 504 RXGVFFFXXPPXXPPPPP 451 R VF PP PPP P Sbjct: 315 RTPVFVSPTPPPPPPPLP 332 Score = 21.0 bits (42), Expect(3) = 3.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 474 PXXPPPPPPXXXXP 433 P PPPP P P Sbjct: 366 PAVPPPPAPLQIAP 379 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 25.8 bits (54), Expect(3) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 477 PPXXPPPPPP 448 PP PPPPPP Sbjct: 349 PPPVPPPPPP 358 Score = 21.8 bits (44), Expect(3) = 3.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 504 RXGVFFFXXPPXXPPPPP 451 R VF PP PPP P Sbjct: 315 RTPVFVSPTPPPPPPPLP 332 Score = 21.0 bits (42), Expect(3) = 3.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 474 PXXPPPPPPXXXXP 433 P PPPP P P Sbjct: 366 PAVPPPPAPLQIAP 379 >U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. Length = 423 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGG 477 GGGG P GGGGG GG Sbjct: 169 GGGGGGPGGGGGGPGGG 185 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 167 PGGGGGGGPGGGGGGPGG 184 >L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcription factor 1 protein. Length = 420 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGG 477 GGGG P GGGGG GG Sbjct: 166 GGGGGGPGGGGGGPGGG 182 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 164 PGGGGGGGPGGGGGGPGG 181 >K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary proline-rich protein 1 gene, segment 1. ). Length = 173 Score = 31.5 bits (68), Expect = 4.3 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPP G K+ + G PP Sbjct: 51 PQGPPPPGKPQGPPPQGGKRSRSPRSPPGKPQGPPP 86 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 77 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 117 >BC033084-1|AAH33084.1| 1164|Homo sapiens formin homology 2 domain containing 1 protein. Length = 1164 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 586 PPLPPPPPIKGPFPPPP 602 >AY192154-1|AAO38757.1| 1164|Homo sapiens FHOS protein. Length = 1164 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 586 PPLPPPPPIKGPFPPPP 602 >AL833083-1|CAD89973.1| 1067|Homo sapiens hypothetical protein protein. Length = 1067 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 488 FFXXPPXXPPPPPXGXXPPPPG 423 F PP PPP P G P PPG Sbjct: 549 FACCPPPPPPPLPPGGPPTPPG 570 >AL590999-1|CAI16176.2| 1068|Homo sapiens dishevelled associated activator of morphogenesis protein. Length = 1068 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 488 FFXXPPXXPPPPPXGXXPPPPG 423 F PP PPP P G P PPG Sbjct: 549 FACCPPPPPPPLPPGGPPTPPG 570 >AL445209-3|CAI15184.1| 419|Homo sapiens POU domain, class 4, transcription factor 1 protein. Length = 419 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGG 477 GGGG P GGGGG GG Sbjct: 165 GGGGGGPGGGGGGPGGG 181 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 163 PGGGGGGGPGGGGGGPGG 180 >AL357412-1|CAI23288.2| 1068|Homo sapiens dishevelled associated activator of morphogenesisorax homolog, Drosophila); tra protein. Length = 1068 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 488 FFXXPPXXPPPPPXGXXPPPPG 423 F PP PPP P G P PPG Sbjct: 549 FACCPPPPPPPLPPGGPPTPPG 570 >AL136089-1|CAI20010.2| 1068|Homo sapiens dishevelled associated activator of morphogenesisacetylgalactosaminyltransferas protein. Length = 1068 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 488 FFXXPPXXPPPPPXGXXPPPPG 423 F PP PPP P G P PPG Sbjct: 549 FACCPPPPPPPLPPGGPPTPPG 570 >AF113615-1|AAD39906.1| 1164|Homo sapiens FH1/FH2 domain-containing protein FHOS protein. Length = 1164 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 586 PPLPPPPPIKGPFPPPP 602 >AB209584-1|BAD92821.1| 1017|Homo sapiens P127 variant protein. Length = 1017 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 439 PPLPPPPPIKGPFPPPP 455 >AB041046-1|BAD06250.1| 1164|Homo sapiens p127 protein. Length = 1164 Score = 31.5 bits (68), Expect = 4.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPP G PPPP Sbjct: 586 PPLPPPPPIKGPFPPPP 602 >AB002379-1|BAA20835.2| 1114|Homo sapiens KIAA0381 protein protein. Length = 1114 Score = 31.5 bits (68), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 488 FFXXPPXXPPPPPXGXXPPPPG 423 F PP PPP P G P PPG Sbjct: 595 FACCPPPPPPPLPPGGPPTPPG 616 >BX537888-1|CAD97884.1| 500|Homo sapiens hypothetical protein protein. Length = 500 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = -3 Query: 476 PPXXPPPPPX----GXXPPPPG 423 PP PPPPP G PPPPG Sbjct: 268 PPPIPPPPPLSSSFGVPPPPPG 289 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXPP 813 PPPP PPP F PP Sbjct: 267 PPPPIPPPPPLSSSFGVPPPPP 288 Score = 24.2 bits (50), Expect(2) = 4.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G PPP PPPP Sbjct: 265 GLPPPPIPPPP 275 >BC018135-1|AAH18135.1| 471|Homo sapiens pre-mRNA cleavage factor I, 59 kDa subunit protein. Length = 471 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = -3 Query: 476 PPXXPPPPPX----GXXPPPPG 423 PP PPPPP G PPPPG Sbjct: 239 PPPIPPPPPLSSSFGVPPPPPG 260 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXPP 813 PPPP PPP F PP Sbjct: 238 PPPPIPPPPPLSSSFGVPPPPP 259 Score = 24.2 bits (50), Expect(2) = 4.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G PPP PPPP Sbjct: 236 GLPPPPIPPPP 246 >AJ275970-1|CAC81661.1| 471|Homo sapiens pre-mRNA cleavage factor I, 59 kDa subunit protein. Length = 471 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = -3 Query: 476 PPXXPPPPPX----GXXPPPPG 423 PP PPPPP G PPPPG Sbjct: 239 PPPIPPPPPLSSSFGVPPPPPG 260 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXPP 813 PPPP PPP F PP Sbjct: 238 PPPPIPPPPPLSSSFGVPPPPP 259 Score = 24.2 bits (50), Expect(2) = 4.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G PPP PPPP Sbjct: 236 GLPPPPIPPPP 246 >AK022591-1|BAB14118.1| 237|Homo sapiens protein ( Homo sapiens cDNA FLJ12529 fis, clone NT2RM4000156, weakly similar to H.sapiens HPBRII-7 gene. ). Length = 237 Score = 31.1 bits (67), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = -3 Query: 476 PPXXPPPPPX----GXXPPPPG 423 PP PPPPP G PPPPG Sbjct: 5 PPPIPPPPPLSSSFGVPPPPPG 26 Score = 25.8 bits (54), Expect(2) = 4.6 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXPP 813 PPPP PPP F PP Sbjct: 4 PPPPIPPPPPLSSSFGVPPPPP 25 Score = 24.2 bits (50), Expect(2) = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G PPP PPPP Sbjct: 2 GLPPPPIPPPP 12 >AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. Length = 772 Score = 25.0 bits (52), Expect(2) = 5.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 748 PPPPPPPPXXF 780 P PPPPPP F Sbjct: 186 PSPPPPPPPVF 196 Score = 24.6 bits (51), Expect(2) = 5.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 733 GXGXXPPPPPPPP 771 G PPPPPPP Sbjct: 182 GSSSPSPPPPPPP 194 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 738 GXXXPPPPPPPXXXXFFFXLXXPPP 812 G PPPPPPP + PPP Sbjct: 580 GAPPPPPPPPPGSAGMMYAPPPPPP 604 Score = 25.4 bits (53), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 476 GMMPPPPPPP 485 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 751 PPPPPPP 771 PPPPPPP Sbjct: 507 PPPPPPP 513 >X64624-1|CAA45907.1| 331|Homo sapiens RDC-1 protein. Length = 331 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 78 PGGGGGGAAGGGGGGPGG 95 >X52979-2|CAA37171.1| 32|Homo sapiens SmB' protein protein. Length = 32 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 9 PPGMRPPPPGMRGPPPPGMR 28 >X17568-1|CAB57868.1| 240|Homo sapiens snRNP B' protein protein. Length = 240 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGMRGPPPPGMR 236 >M34082-1|AAA36579.1| 233|Homo sapiens protein ( Human small nuclear ribonucleoprotein particle SmB' mRNA, 3' end. ). Length = 233 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 210 PPGMRPPPPGMRGPPPPGMR 229 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 738 GXXXPPPPPPPXXXXFFFXLXXPPP 812 G PPPPPPP + PPP Sbjct: 580 GAPPPPPPPPPVSAGMMYAPPPPPP 604 Score = 25.4 bits (53), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 476 GMMPPPPPPP 485 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 751 PPPPPPP 771 PPPPPPP Sbjct: 507 PPPPPPP 513 >J04564-1|AAA60151.1| 285|Homo sapiens SNRPB protein. Length = 285 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPP G PPPG Sbjct: 169 PPGLGPPPPMGRGAPPPG 186 >D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. Length = 623 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternatively spliced product protein. Length = 548 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >CR533459-1|CAG38490.1| 148|Homo sapiens DKFZP564J157 protein. Length = 148 Score = 31.1 bits (67), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAP 369 PP PP P G PPPPG GG P Sbjct: 29 PPPINPPFPPGPCPPPPGAPHGNPAFPSGGPPHPVP 64 >CR456969-1|CAG33250.1| 240|Homo sapiens SNRPB protein. Length = 240 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGMRGPPPPGMR 236 >BC066943-1|AAH66943.1| 148|Homo sapiens proline rich 13 protein. Length = 148 Score = 31.1 bits (67), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAP 369 PP PP P G PPPPG GG P Sbjct: 29 PPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVP 64 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 P PPPPP PPPPG Sbjct: 71 PGPPPPPPPPPPPPPPPG 88 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPP P G PP PG Sbjct: 488 PPRLPPPAPPGIPPPRPG 505 >BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPP P G PP PG Sbjct: 247 PPRLPPPAPPGIPPPRPG 264 >BC016064-1|AAH16064.1| 148|Homo sapiens proline rich 13 protein. Length = 148 Score = 31.1 bits (67), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAP 369 PP PP P G PPPPG GG P Sbjct: 29 PPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVP 64 >BC014257-1|AAH14257.1| 148|Homo sapiens proline rich 13 protein. Length = 148 Score = 31.1 bits (67), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAP 369 PP PP P G PPPPG GG P Sbjct: 29 PPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVP 64 >BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 479 PP--PPPPPSGQPPPPP 493 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPP P G PP PG Sbjct: 488 PPRLPPPAPPGIPPPRPG 505 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPP 426 PP PPPPP G PPPP Sbjct: 105 PP--PPPPPSGQPPPPP 119 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 738 GXXXPPPPPPPXXXXFFFXLXXPPP 812 G PPPPPPP + PPP Sbjct: 206 GAPPPPPPPPPGSAGMMYAPPPPPP 230 Score = 25.4 bits (53), Expect(2) = 7.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 102 GMMPPPPPPP 111 Score = 23.8 bits (49), Expect(2) = 7.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 751 PPPPPPP 771 PPPPPPP Sbjct: 133 PPPPPPP 139 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 P PPPPP PPPPG Sbjct: 66 PGPPPPPPPPPPPPPPPG 83 >AL049650-8|CAB46715.1| 240|Homo sapiens small nuclear ribonucleoprotein polypeptides B and B1 protein. Length = 240 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGMRGPPPPGMR 236 >AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. Length = 1766 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 474 PXXPPPPPPXXXXPPPXXK 418 P PPPPPP PPP K Sbjct: 1171 PIPPPPPPPPLPPPPPVIK 1189 >AK024089-1|BAB14822.1| 593|Homo sapiens protein ( Homo sapiens cDNA FLJ14027 fis, clone HEMBA1003827. ). Length = 593 Score = 31.1 bits (67), Expect = 5.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPP + GG Sbjct: 367 PQPPPPPPPASQQPPPPSPPQAPVRLPPGG 396 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 P PPPPP PPPPG Sbjct: 71 PGPPPPPPPPPPPPPPPG 88 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 P PPPPP PPPPG Sbjct: 71 PGPPPPPPPPPPPPPPPG 88 >AF134825-1|AAD54489.1| 243|Homo sapiens small nuclear ribonucleoprotein B' protein. Length = 243 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 220 PPGMRPPPPGMRGPPPPGMR 239 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPP P G PP PG Sbjct: 488 PPRLPPPAPPGIPPPRPG 505 >AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. Length = 1822 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 474 PXXPPPPPPXXXXPPPXXK 418 P PPPPPP PPP K Sbjct: 1350 PIPPPPPPPPLPPPPPVIK 1368 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 31.1 bits (67), Expect = 5.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPP P G PP PG Sbjct: 488 PPRLPPPAPPGIPPPRPG 505 >BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 306 Score = 25.4 bits (53), Expect(2) = 5.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 KKK G GGGGGG Sbjct: 222 KKKGDGGGAGGGGGG 236 Score = 24.2 bits (50), Expect(2) = 5.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 770 GGGGGGGGXXPXPXPP 723 G GGGGGG P P Sbjct: 243 GSGGGGGGGSSRPPAP 258 >AL031668-5|CAI22150.1| 306|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 306 Score = 25.4 bits (53), Expect(2) = 5.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 KKK G GGGGGG Sbjct: 222 KKKGDGGGAGGGGGG 236 Score = 24.2 bits (50), Expect(2) = 5.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 770 GGGGGGGGXXPXPXPP 723 G GGGGGG P P Sbjct: 243 GSGGGGGGGSSRPPAP 258 >AF148457-1|AAF04487.1| 306|Homo sapiens heterogeneous nuclear ribonucleoprotein, alternate transcript protein. Length = 306 Score = 25.4 bits (53), Expect(2) = 5.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 KKK G GGGGGG Sbjct: 222 KKKGDGGGAGGGGGG 236 Score = 24.2 bits (50), Expect(2) = 5.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 770 GGGGGGGGXXPXPXPP 723 G GGGGGG P P Sbjct: 243 GSGGGGGGGSSRPPAP 258 >AL031668-6|CAB43742.1| 290|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 290 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 KKK G GGGGGG Sbjct: 206 KKKGDGGGAGGGGGG 220 Score = 24.2 bits (50), Expect(2) = 5.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 770 GGGGGGGGXXPXPXPP 723 G GGGGGG P P Sbjct: 227 GSGGGGGGGSSRPPAP 242 >AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant protein protein. Length = 856 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPPP Sbjct: 432 GLGQRATPPPPPPP 445 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPP P Sbjct: 486 PPPPPPRP 493 >AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPPP Sbjct: 404 GLGQRATPPPPPPP 417 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPP P Sbjct: 458 PPPPPPRP 465 >AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPPP Sbjct: 404 GLGQRATPPPPPPP 417 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPP P Sbjct: 458 PPPPPPRP 465 >AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPPP Sbjct: 404 GLGQRATPPPPPPP 417 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPP P Sbjct: 458 PPPPPPRP 465 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 26.6 bits (56), Expect(2) = 7.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 594 PPPPPPPP 601 Score = 22.6 bits (46), Expect(2) = 7.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 552 GIVLGPLAPPPPPP 565 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 26.6 bits (56), Expect(2) = 7.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 594 PPPPPPPP 601 Score = 22.6 bits (46), Expect(2) = 7.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 552 GIVLGPLAPPPPPP 565 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 26.6 bits (56), Expect(2) = 7.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 347 PPPPPPPP 354 Score = 22.6 bits (46), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 305 GIVLGPLAPPPPPP 318 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 26.6 bits (56), Expect(2) = 7.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 347 PPPPPPPP 354 Score = 22.6 bits (46), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 305 GIVLGPLAPPPPPP 318 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 26.6 bits (56), Expect(2) = 7.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 347 PPPPPPPP 354 Score = 22.6 bits (46), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 305 GIVLGPLAPPPPPP 318 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 26.6 bits (56), Expect(2) = 7.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 347 PPPPPPPP 354 Score = 22.6 bits (46), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 305 GIVLGPLAPPPPPP 318 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 26.6 bits (56), Expect(2) = 7.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 347 PPPPPPPP 354 Score = 22.6 bits (46), Expect(2) = 7.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 305 GIVLGPLAPPPPPP 318 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 26.6 bits (56), Expect(2) = 7.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 304 PPPPPPPP 311 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 262 GIVLGPLAPPPPPP 275 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 26.6 bits (56), Expect(2) = 7.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPPPP Sbjct: 244 PPPPPPPP 251 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPP Sbjct: 202 GIVLGPLAPPPPPP 215 >BC022464-1|AAH22464.1| 459|Homo sapiens FEZ family zinc finger 2 protein. Length = 459 Score = 25.4 bits (53), Expect(2) = 7.3 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 770 GGGGGGGGXXP 738 GGGGGGGG P Sbjct: 109 GGGGGGGGGAP 119 Score = 23.8 bits (49), Expect(2) = 7.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 K GGGGGGGG Sbjct: 96 KSSLRAGGGGGGGGG 110 >X52282-1|CAA36523.1| 540|Homo sapiens precursor protein (AA -18 to 522) protein. Length = 540 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGG G GG +++ PP Sbjct: 25 GGGGVGGGGGGAGIGGGRQEREALPP 50 >X16163-1|CAA34288.1| 218|Homo sapiens SmB /B' autoimmune antigene protein. Length = 218 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 195 PPGMRPPPPGIRGPPPPGMR 214 >X15892-1|CAA33901.1| 240|Homo sapiens protein ( Human hcerN3 gene mRNA for N snRNP associated protein. ). Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 protein. Length = 309 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 257 PQRPPPPRRPQGPPPPGGNPQQPLPPPAGKPQGPPP 292 >X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. Length = 234 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 181 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPP 216 >U87166-1|AAC39757.1| 508|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 508 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPPP F PPP Sbjct: 395 PPPPPPPDDIPMFDDFPPPPP 415 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 751 PPPPPPPXXFXFFFXFXXXPP 813 PPPPPPP F F PP Sbjct: 395 PPPPPPPDDIPMFDDFPPPPP 415 >U41303-1|AAA98969.1| 240|Homo sapiens small nuclear ribonuleoprotein particle N protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. Length = 238 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 185 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPP 220 >S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. Length = 382 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPP G K + G PP Sbjct: 116 PQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPP 151 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPP G K + G PP Sbjct: 178 PQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPP 213 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 19 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 59 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 80 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 120 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 142 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 182 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 204 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKSQGPP 244 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 266 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 306 >M93119-1|AAA58680.1| 510|Homo sapiens IA-1 protein. Length = 510 Score = 30.7 bits (66), Expect = 7.5 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +2 Query: 428 GGGXXXXGGGGGGXXGGXKKKKTPXLXFIXKKNXXXXRXXKXXPXPPPPLXXGFXFXKKK 607 GGG G GGGG GG P + + P P PPL Sbjct: 141 GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARG-PGPGPPLPPAAALRPPG 199 Query: 608 KXXPPP 625 K PPP Sbjct: 200 KRPPPP 205 >M59305-1|AAA51734.1| 541|Homo sapiens atrial natriuretic peptide clearance receptor protein. Length = 541 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGG G GG +++ PP Sbjct: 25 GGGGVGGGGGGAGIGGGRQEREALPP 50 >L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiesterase protein. Length = 809 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 P PPPPP PPPPG Sbjct: 72 PLQPPPPPPLPPPPPPPG 89 >K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. Length = 251 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPP G K + G PP Sbjct: 47 PQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPP 82 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 11 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 51 Score = 30.3 bits (65), Expect = 10.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 476 PPXXP--PPPPXGXXP--PPPGXKKXXXXKKXGGXKXXAPP 366 PP P PPP G P PPP K GG K PP Sbjct: 135 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 175 >J04615-1|AAA36617.1| 240|Homo sapiens protein ( Human lupus autoantigen (small nuclear ribonuclepoprotein, snRNP, SM-D) mRNA, complete cds. ). Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >CR450350-1|CAG29346.1| 240|Homo sapiens SNRPN protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >BC131540-1|AAI31541.1| 541|Homo sapiens natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide re protein. Length = 541 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGG G GG +++ PP Sbjct: 25 GGGGVGGGGGGAGIGGGRQEREALPP 50 >BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. Length = 268 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 215 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPP 250 >BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. Length = 183 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 125 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPP 160 >BC121793-1|AAI21794.1| 837|Homo sapiens family with sequence similarity 40, member A protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >BC119814-1|AAI19815.1| 837|Homo sapiens family with sequence similarity 40, member A protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. Length = 162 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 110 PQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPP 145 >BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 257 PQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPP 292 >BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 257 PQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPP 292 >BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGGXKXXAPP 366 P PPPP PPPPG G PP Sbjct: 257 PQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPP 292 >BC094786-1|AAH94786.1| 837|Homo sapiens family with sequence similarity 40, member A protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >BC025178-1|AAH25178.1| 240|Homo sapiens small nuclear ribonucleoprotein polypeptide N protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >BC024777-1|AAH24777.1| 240|Homo sapiens SNURF protein protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >BC020238-1|AAH20238.1| 596|Homo sapiens SRP68 protein protein. Length = 596 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 8 PGGGGGGGSGGGGGSGGG 25 >BC003180-1|AAH03180.1| 240|Homo sapiens small nuclear ribonucleoprotein polypeptide N protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >BC000611-1|AAH00611.1| 240|Homo sapiens SNRPN protein protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >AL772411-3|CAH70967.1| 837|Homo sapiens family with sequence similarity 40, member A protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >AL161658-1|CAC36065.1| 510|Homo sapiens insulinoma-associated 1 protein. Length = 510 Score = 30.7 bits (66), Expect = 7.5 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +2 Query: 428 GGGXXXXGGGGGGXXGGXKKKKTPXLXFIXKKNXXXXRXXKXXPXPPPPLXXGFXFXKKK 607 GGG G GGGG GG P + + P P PPL Sbjct: 141 GGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARG-PGPGPPLPPAAALRPPG 199 Query: 608 KXXPPP 625 K PPP Sbjct: 200 KRPPPP 205 >AL160006-2|CAI22715.1| 837|Homo sapiens family with sequence similarity 40, member A protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >AL121749-3|CAC10185.1| 694|Homo sapiens frizzled homolog 8 (Drosophila) protein. Length = 694 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 644 PGGGGGGGPGGGGGPGGG 661 >AK222633-1|BAD96353.1| 240|Homo sapiens small nuclear ribonucleoprotein polypeptide N variant protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >AK074698-1|BAC11145.1| 627|Homo sapiens protein ( Homo sapiens cDNA FLJ90217 fis, clone MAMMA1002234, highly similar to SIGNAL RECOGNITION PARTICLE 68 KD PROTEIN. ). Length = 627 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 8 PGGGGGGGSGGGGGSGGG 25 >AF540955-1|AAN28379.1| 476|Homo sapiens Abl-interactor 1 protein. Length = 476 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 750 PPPPPPPXXXXFFFXLXXPPP 812 PPPPPPP F PPP Sbjct: 363 PPPPPPPDDIPMFDDFPPPPP 383 Score = 30.3 bits (65), Expect = 10.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 751 PPPPPPPXXFXFFFXFXXXPP 813 PPPPPPP F F PP Sbjct: 363 PPPPPPPDDIPMFDDFPPPPP 383 >AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 30.7 bits (66), Expect = 7.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKKXGXXXXXGA 370 PP PPPPPP PPP + + G GA Sbjct: 785 PPRAPPPPPP--PPPPPPRMRSPQPARPGSAAVPGA 818 >AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 30.7 bits (66), Expect = 7.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKKXGXXXXXGA 370 PP PPPPPP PPP + + G GA Sbjct: 785 PPRAPPPPPP--PPPPPPRMRSPQPARPGSAAVPGA 818 >AF400432-1|AAK92481.1| 240|Homo sapiens small nuclear ribonucleoprotein polypeptide N protein. Length = 240 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 217 PPGMRPPPPGIRGPPPPGMR 236 >AF195951-1|AAF24308.1| 619|Homo sapiens signal recognition particle 68 protein. Length = 619 Score = 30.7 bits (66), Expect = 7.5 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGGG GG K+N P Sbjct: 11 GGGGGGSGGGGGRGAGGEENKENERP 36 >AF134832-1|AAD54487.1| 47|Homo sapiens small nuclear ribonucleoprotein N protein. Length = 47 Score = 30.7 bits (66), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPGXK 417 PP PPPP PPPPG + Sbjct: 24 PPGMRPPPPGIRGPPPPGMR 43 >AF025998-1|AAB88801.1| 540|Homo sapiens atrial natriuretic peptide clearance receptor protein. Length = 540 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGG G GG +++ PP Sbjct: 25 GGGGVGGGGGGAGIGGGRQEREALPP 50 >AB101582-1|BAC56126.1| 540|Homo sapiens natriuretic peptide receptor C protein. Length = 540 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 427 GGGGXXPXGGGGGXXGGXXKKKNXPP 504 GGGG GGG G GG +++ PP Sbjct: 25 GGGGVGGGGGGAGIGGGRQEREALPP 50 >AB051548-1|BAB21852.2| 837|Homo sapiens KIAA1761 protein protein. Length = 837 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPPGXKKXXXXKKXGG 387 P PPPPP PPPG + GG Sbjct: 18 PQPPPPPPPAAAQPPPGAPRAAAGLLPGG 46 >AB043703-1|BAB41064.1| 694|Homo sapiens seven-transmembrane receptor Frizzled-8 protein. Length = 694 Score = 30.7 bits (66), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 424 PGGGGXXPXGGGGGXXGG 477 PGGGG GGGGG GG Sbjct: 644 PGGGGGGGPGGGGGPGGG 661 >AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. Length = 1015 Score = 30.7 bits (66), Expect = 7.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKKXXXXKKXGXXXXXGA 370 PP PPPPPP PPP + + G GA Sbjct: 897 PPRAPPPPPP--PPPPPPRMRSPQPARPGSAAVPGA 930 >AK001004-1|BAA91464.1| 304|Homo sapiens protein ( Homo sapiens cDNA FLJ10142 fis, clone HEMBA1003257. ). Length = 304 Score = 25.4 bits (53), Expect(2) = 7.6 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 770 GGGGGGGGXXP 738 GGGGGGGG P Sbjct: 109 GGGGGGGGGAP 119 Score = 23.8 bits (49), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 791 KKKXXXXGGGGGGGG 747 K GGGGGGGG Sbjct: 96 KSSLRAGGGGGGGGG 110 >BC033513-1|AAH33513.1| 265|Homo sapiens Unknown (protein for IMAGE:5172161) protein. Length = 265 Score = 26.2 bits (55), Expect(2) = 7.7 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 727 GXGXGXXPPPPPPP 768 G G PPPPPPP Sbjct: 123 GSGDTQPPPPPPPP 136 Score = 23.0 bits (47), Expect(2) = 7.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPPPPP P Sbjct: 131 PPPPPPRP 138 >U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated protein protein. Length = 872 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 77 PPLQPPPPPP---PPPPG 91 Score = 27.9 bits (59), Expect(2) = 9.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXP 810 PPPPPPPP F P Sbjct: 82 PPPPPPPPPGLGLGFPMAHPP 102 Score = 21.0 bits (42), Expect(2) = 9.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G P PPPPP Sbjct: 75 GLPPLQPPPPP 85 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 25.4 bits (53), Expect(2) = 9.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 739 GXXPPPPPPP 768 G PPPPPPP Sbjct: 345 GPPPPPPPPP 354 Score = 23.4 bits (48), Expect(2) = 9.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 748 PPPPPPPP 771 PPP PPPP Sbjct: 367 PPPAPPPP 374 >BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein protein. Length = 799 Score = 30.3 bits (65), Expect = 10.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 476 PPXXPPPPPXGXXPPPPG 423 PP PPPPP PPPPG Sbjct: 102 PPLQPPPPPP---PPPPG 116 Score = 27.9 bits (59), Expect(2) = 9.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 748 PPPPPPPPXXFXFFFXFXXXP 810 PPPPPPPP F P Sbjct: 107 PPPPPPPPPGLGLGFPMAHPP 127 Score = 21.0 bits (42), Expect(2) = 9.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 739 GXXPPPPPPPP 771 G P PPPPP Sbjct: 100 GLPPLQPPPPP 110 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 473 PXXPPPPPXGXXPPPP 426 P PPPPP PPPP Sbjct: 350 PPPPPPPPASPLPPPP 365 >X78202-1|CAA55038.1| 469|Homo sapiens HBF-G2 (HFK-2) protein. Length = 469 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPP PPP ++ Sbjct: 60 PPAPQPPPPPQQQQPPPPPRR 80 >X74143-1|CAA52240.1| 469|Homo sapiens transcription factor protein. Length = 469 Score = 30.3 bits (65), Expect = 10.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 477 PPXXPPPPPPXXXXPPPXXKK 415 PP PPPPP PPP ++ Sbjct: 60 PPAPQPPPPPQQQQPPPPPRR 80 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,740,828 Number of Sequences: 237096 Number of extensions: 2711026 Number of successful extensions: 82791 Number of sequences better than 10.0: 320 Number of HSP's better than 10.0 without gapping: 7221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42120 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11603768198 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -