BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F18 (924 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-53... 29 5.2 06_03_0849 - 25344261-25344416,25344652-25344808,25344917-253450... 28 9.1 >12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-538255, 538601-538860,539950-540073,540978-541310,541447-541531, 541683-541768,541843-541941,542041-542180,542717-543043, 543163-543774,543887-543971,543972-544067,544147-544500, 544536-544559,544597-544707,544811-544894,545468-545546, 546122-546279,546412-546528,546622-546780,546857-546939, 547525-547627,549184-549495 Length = 1925 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -1 Query: 615 SILLSTDPRQYS*LLTSSATYAAHADSSR**PASLHWTTYTAR-DTDGYSEESTLKGTLV 439 S+LL DP +L+S YA+ D+ HW +R D E +G +V Sbjct: 1398 SLLLDPDPASCRAVLSSLCQYASAQDAVAFLDKMCHWGISPSRSDYHAVFEALLQEGKVV 1457 Query: 438 SRRDLMRNK 412 ++M+NK Sbjct: 1458 EAYEVMKNK 1466 >06_03_0849 - 25344261-25344416,25344652-25344808,25344917-25345056, 25345160-25345295,25345392-25345663,25345809-25346068, 25346716-25347035,25347287-25347352,25347439-25347510, 25347609-25347680,25347776-25347858,25348068-25348139, 25348389-25348485,25348918-25349050,25349158-25349236 Length = 704 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 408 SIYYASNLFEILASLSRLTPRSNHPYPGLCRLSNGETLVI 527 S+Y N E+++S+SRL + P G C + +G+ L++ Sbjct: 431 SLYEEDNFLEVVSSISRLRHPNIVPLAGYC-VEHGQRLLV 469 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,218,732 Number of Sequences: 37544 Number of extensions: 425140 Number of successful extensions: 914 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2635816500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -