BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F16 (1020 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 40 0.003 At1g61080.1 68414.m06877 proline-rich family protein 39 0.006 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 36 0.033 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.033 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 36 0.043 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 35 0.075 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.075 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.099 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.13 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.23 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 33 0.23 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 0.24 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 33 0.30 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 33 0.30 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.30 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 33 0.30 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 33 0.40 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 32 0.53 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 32 0.53 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 32 0.70 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 31 0.93 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 26 1.5 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 31 1.6 At4g01985.1 68417.m00265 expressed protein 31 1.6 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 1.6 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 31 1.6 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 1.6 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 31 1.6 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 30 2.1 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 2.1 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 2.1 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 30 2.1 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 30 2.1 At3g24550.1 68416.m03083 protein kinase family protein contains ... 30 2.1 At5g46730.1 68418.m05757 glycine-rich protein 30 2.8 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 30 2.8 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 30 2.8 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 30 2.8 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 2.8 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 29 3.7 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 3.7 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 29 4.9 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 29 4.9 At2g05440.2 68415.m00575 glycine-rich protein 29 4.9 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 4.9 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 29 4.9 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 29 4.9 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 4.9 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 29 6.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 6.5 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 6.5 At4g18570.1 68417.m02749 proline-rich family protein common fami... 29 6.5 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 6.5 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 6.5 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 6.5 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 6.5 At1g27710.1 68414.m03387 glycine-rich protein 29 6.5 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 8.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 28 8.6 At4g33660.1 68417.m04781 expressed protein 28 8.6 At3g24250.1 68416.m03044 glycine-rich protein 28 8.6 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 8.6 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 24 9.8 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.9 bits (89), Expect = 0.003 Identities = 33/132 (25%), Positives = 35/132 (26%), Gaps = 4/132 (3%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPP---PPPPXKXXXPXXXPAPXLKXGXX 782 P P P P P PP V+ PP PPPP P P P Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYS 511 Query: 783 TPRPXFLXXSXPXXXPAXTPL-PGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXP 959 P P P PA TP+ P PP H P Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP 571 Query: 960 XXXXTPPEXXPP 995 PP PP Sbjct: 572 PHSPPPPHSPPP 583 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/80 (28%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPP---PPXKXXXPXXXPAPXLKXGXXTPRPXFL 803 P P P P PP + PPPP PP P P P + +P P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYP-YLSPPPPPT 596 Query: 804 XXSXPXXXPAXTPLPGXPXL 863 S P P +P P P + Sbjct: 597 PVSSPPPTPVYSPPPPPPCI 616 Score = 36.3 bits (80), Expect = 0.033 Identities = 30/128 (23%), Positives = 36/128 (28%) Frame = +3 Query: 630 APXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXX 809 +P P P P PP PPPPPP P P P +P P Sbjct: 430 SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP---PS 486 Query: 810 SXPXXXPAXTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXPXXXXTPPEXX 989 P P +P P P + P T + PP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSP-PPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP 545 Query: 990 PPXQTNXP 1013 PP Q + P Sbjct: 546 PPPQFSPP 553 Score = 33.5 bits (73), Expect = 0.23 Identities = 35/144 (24%), Positives = 41/144 (28%), Gaps = 10/144 (6%) Frame = +3 Query: 612 PXKKXXAPXRPXK--------GPQXP*XRPPAXXGVFXXXP--PPPPPXKXXXPXXXPAP 761 P +P P P P PP V+ P PPPPP P P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Query: 762 XLKXGXXTPRPXFLXXSXPXXXPAXTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXX 941 +P P + S P P +P P P TR PP Sbjct: 504 PPPPPVYSPPPPPVYSSPP---PPPSPAP-TPVYCTRPPPPPPHSPPPPQFSPPPPEPYY 559 Query: 942 THXHXPXXXXTPPEXXPPXQTNXP 1013 P PP PP + P Sbjct: 560 YSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/68 (30%), Positives = 24/68 (35%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPA 833 P P PP V+ PPPPPP P P P +P P P P Sbjct: 426 PPPPSPPPP----VYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP--PPPPPPPPPV 479 Query: 834 XTPLPGXP 857 +P P P Sbjct: 480 YSPPPPSP 487 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/83 (28%), Positives = 27/83 (32%) Frame = +3 Query: 639 RPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXP 818 +P KG P PP PPPPPP + P P P P P Sbjct: 501 KPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP-----PPP 555 Query: 819 XXXPAXTPLPGXPXLXTRXRFPP 887 A P P P + R PP Sbjct: 556 PGTQAAPPPPPPPPMQNRAPSPP 578 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/70 (27%), Positives = 24/70 (34%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P + P PP PPPPPP P P P ++ +P P + S Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNS 585 Query: 813 XPXXXPAXTP 842 P P Sbjct: 586 GSGGPPPPPP 595 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/66 (27%), Positives = 20/66 (30%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P P PP V PPPPP P P P + P P + Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNR 573 Query: 813 XPXXXP 830 P P Sbjct: 574 APSPPP 579 Score = 29.9 bits (64), Expect = 2.8 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPA 833 P P PPA + PPPPPP P P TP P F P A Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPP---LPPAVMPLKHFAPPPPTP-PAF----KPLKGSA 507 Query: 834 XTPLPGXPXLXTRXRFPP 887 P P P L T PP Sbjct: 508 PPP-PPPPPLPTTIAAPP 524 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/82 (28%), Positives = 25/82 (30%) Frame = +3 Query: 642 PXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPX 821 P K P PPA + PPPPPP P P P P Sbjct: 486 PLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAP---PPPPPP 542 Query: 822 XXPAXTPLPGXPXLXTRXRFPP 887 A P P P T+ PP Sbjct: 543 PGTAAAPPPPPPPPGTQAAPPP 564 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/85 (28%), Positives = 29/85 (34%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P +P P+ P +PP PP PP P P K TP+P Sbjct: 105 PTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKP-----PTTKPPPSTPKPPH-HKP 158 Query: 813 XPXXXPAXTPLPGXPXLXTRXRFPP 887 P P TP P P + PP Sbjct: 159 PPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 32.7 bits (71), Expect = 0.40 Identities = 22/86 (25%), Positives = 28/86 (32%), Gaps = 1/86 (1%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPP-PXKXXXPXXXPAPXLKXGXXTPRPXFLXX 809 P P K P+ P +PP V P PP P P P P+P + Sbjct: 40 PKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKP 99 Query: 810 SXPXXXPAXTPLPGXPXLXTRXRFPP 887 P P P P + + PP Sbjct: 100 PHPKPPTKPHPHPKPPIVKPPTKPPP 125 Score = 29.1 bits (62), Expect = 4.9 Identities = 25/102 (24%), Positives = 31/102 (30%), Gaps = 1/102 (0%) Frame = +1 Query: 610 TPXKKXXPXXGPXRGPXXRKXGPPLXLGFFXXXRPPPPPGKXXYXNXXPRPXLKXGQXPP 789 TP K P + P P + +PP P + P P +K PP Sbjct: 28 TPPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKP-PTVKPHPKPP 86 Query: 790 ARXFXPXXXXX-PXRXKLPSXAXPXXXPAXAFPPXXRPPXLP 912 P P K P+ P P PP PP P Sbjct: 87 TVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTP 128 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/83 (25%), Positives = 25/83 (30%), Gaps = 1/83 (1%) Frame = +1 Query: 709 RPPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPP 888 +PPP K + P P PP P P P P PP Sbjct: 145 KPPPSTPKPPHHKPPPTPC------PPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPP 198 Query: 889 XXRPPXL-PPWEXXRALXPLTXT 954 PP + PP + P T T Sbjct: 199 TPTPPVITPPTPTPPVITPPTPT 221 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 36.3 bits (80), Expect = 0.033 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +3 Query: 630 APXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXX 809 AP P GP PP PPPPPP K P P K G P P + Sbjct: 371 APPAPP-GPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSK 429 Query: 810 SXPXXXP 830 P P Sbjct: 430 KGPPKPP 436 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTP 788 P + P P P PP G PPPPP K P P P K G P Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGP-PPPPPMSKKGPPKP 435 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPP-PPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXP 830 P P PP V PP PPP P P + TP P + P P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 831 AXTPLPGXP 857 TP P P Sbjct: 137 PPTPTPSVP 145 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/85 (25%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPP---PPXKXXXPXXXPAPXLKXGXX 782 P P P P PP P PP PP P P + Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Query: 783 TPRPXFLXXSXPXXXPAXTPLPGXP 857 TP P + P P TP P P Sbjct: 139 TPTPSVPSPTPPVSPPPPTPTPSVP 163 Score = 31.1 bits (67), Expect = 1.2 Identities = 30/124 (24%), Positives = 35/124 (28%), Gaps = 2/124 (1%) Frame = +3 Query: 630 APXRPXKGPQXP*XRPPAXXGVFXXXP--PPPPPXKXXXPXXXPAPXLKXGXXTPRPXFL 803 +P P P P PP P P P P P P P + TP P Sbjct: 134 SPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP--- 190 Query: 804 XXSXPXXXPAXTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXPXXXXTPPE 983 S P P TP P P + + P T P +PP Sbjct: 191 --SVP-SPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPY 247 Query: 984 XXPP 995 PP Sbjct: 248 VPPP 251 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.1 bits (77), Expect = 0.075 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 2/82 (2%) Frame = +1 Query: 676 PPLXLGF--FXXXRPPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSX 849 PPL F +PPPPP + N P L P P P LPS Sbjct: 532 PPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQ----PINKTPPPPPPPPP--PLPSR 585 Query: 850 AXPXXXPAXAFPPXXRPPXLPP 915 + P P A PP RPP PP Sbjct: 586 SIP---PPLAQPPPPRPPPPPP 604 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/96 (22%), Positives = 26/96 (27%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLPGXPXLXTRXRFPP 887 PPPPPP +P P P F+ + P P P + F P Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSP 543 Query: 888 XXXXXXXXXXXXXXXXXXTHXHXPXXXXTPPEXXPP 995 T H P PP PP Sbjct: 544 SQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPP 579 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRP 794 P P PP+ + PPPPPP P P P K P P Sbjct: 698 PPAPPPLPPSSTRL-GAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 28.7 bits (61), Expect = 6.5 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P K P P P PP PPPPPP P+P P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPP-PPPSSRSIPSPSAPPPPPPPP 625 Query: 792 PXFLXXSXPXXXPAXTPLPGXPXLXTR 872 P F S A P P P TR Sbjct: 626 PSF--GSTGNKRQAQPPPPPPPPPPTR 650 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +3 Query: 642 PXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPX 821 P P P R PA PPPPPP P P P S Sbjct: 640 PPPPPPPPPTRIPAAK---CAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAP 696 Query: 822 XXPAXTPLP 848 PA PLP Sbjct: 697 KPPAPPPLP 705 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.1 bits (77), Expect = 0.075 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPP--PPPPXKXXXPXXXPAPXLKXGXXTPRPXFLX 806 P P P P PP V P PPPP P P P P Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 Query: 807 XSXPXXXPAXTPLPGXPXLXTRXRFPP 887 S P P PLP P L PP Sbjct: 155 PSLPAPDPPSNPLP-PPKLVPPSHSPP 180 Score = 30.3 bits (65), Expect = 2.1 Identities = 23/70 (32%), Positives = 25/70 (35%) Frame = +1 Query: 712 PPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPX 891 PPP P P P L G P P P LP+ A P P + PP Sbjct: 71 PPPEPSP-------PSPSLT-GPPPTTIPVSPPPEPSPP-PPLPTEAPPPANPVSSPPPE 121 Query: 892 XRPPXLPPWE 921 PP PP E Sbjct: 122 SSPPPPPPTE 131 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.099 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 5/97 (5%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XR----PPAXXGVFXXXPPPPP-PXKXXXPXXXPAPXLKXG 776 P K AP P P P PPA PPP P P P P P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Query: 777 XXTPRPXFLXXSXPXXXPAXTPLPGXPXLXTRXRFPP 887 P P P P P P P T PP Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 30.3 bits (65), Expect = 2.1 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 1/83 (1%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXP-PPPPPXKXXXPXXXPAPXLKXGXXTP 788 P K AP P P P P P PPP P P P P K Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPA 67 Query: 789 RPXFLXXSXPXXXPAXTPLPGXP 857 P P P P P P Sbjct: 68 CPPTPPKPQPKPAPPPEPKPAPP 90 Score = 30.3 bits (65), Expect = 2.1 Identities = 28/120 (23%), Positives = 31/120 (25%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPA 833 P P +P A G PPP P P P+P P P P PA Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSP-------CPSPPPKPQPKPVPPPA 67 Query: 834 XTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXPXXXXTPPEXXPPXQTNXP 1013 P P P + PP P PP PP P Sbjct: 68 CPPTPPKP--QPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/69 (24%), Positives = 21/69 (30%) Frame = +1 Query: 709 RPPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPP 888 +PPP P + P+P K P P P P A P P Sbjct: 41 KPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPS 100 Query: 889 XXRPPXLPP 915 +PP P Sbjct: 101 PPKPPAPTP 109 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P K P P P +PPA PP PP K P PAP K P+ Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTP--KPVPPHGPPPKPA-PAPTPAPSPKPAPSPPK 139 Query: 792 P 794 P Sbjct: 140 P 140 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.3 bits (75), Expect = 0.13 Identities = 24/101 (23%), Positives = 33/101 (32%) Frame = +1 Query: 613 PXKKXXPXXGPXRGPXXRKXGPPLXLGFFXXXRPPPPPGKXXYXNXXPRPXLKXGQXPPA 792 P P P P + PP + + + PPPP Y P + PP+ Sbjct: 684 PPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYY------PPVAKSPPPPS 737 Query: 793 RXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPXXRPPXLPP 915 + P P P P P + PP + P PP Sbjct: 738 PVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSP--PP 776 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 708 PPPPPPXKXXXPXXX---PAPXLKXGXXTPRPXFLXXSXPXXXPAXTP 842 P PPPP P P P L +P P ++ S P P+ P Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 29.1 bits (62), Expect = 4.9 Identities = 26/104 (25%), Positives = 30/104 (28%), Gaps = 8/104 (7%) Frame = +1 Query: 631 PXXGPXRGPXXRKXGPPLXLGFFXXXR--PPPP-----PGKXXYXNXXPRPXLKXGQXPP 789 P P R PP R PPPP P Y P P + PP Sbjct: 457 PPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Query: 790 ARXFXPXXXXXPXRXKL-PSXAXPXXXPAXAFPPXXRPPXLPPW 918 + P P L P P + PP P PP+ Sbjct: 517 SSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPY 560 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRP 794 P P PP PPPPPP + P P P PRP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRP 70 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 33.5 bits (73), Expect = 0.23 Identities = 30/127 (23%), Positives = 34/127 (26%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P K P+ P +PP PPPP P P P P P Sbjct: 42 PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV--KPPPPPYVKPPP 99 Query: 813 XPXXXPAXTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXPXXXXTPPEXXP 992 P P P P T + PP T P TPP P Sbjct: 100 PPTVKPPPPPYVKPPPPPT-VKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Query: 993 PXQTNXP 1013 + P Sbjct: 159 TPEAPCP 165 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/70 (31%), Positives = 24/70 (34%) Frame = +3 Query: 648 KGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXX 827 K P P +PP + PPPP P P P P TP P P Sbjct: 112 KPPPPPTVKPPPPPTPYT--PPPPTPYTPPPPTVKPPPP---PVVTPPPPTPTPEAPCPP 166 Query: 828 PAXTPLPGXP 857 P TP P P Sbjct: 167 PPPTPYPPPP 176 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.1 bits (62), Expect(2) = 0.24 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPP 725 P + AP P P PP + PPPPPP Sbjct: 15 PSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 24.6 bits (51), Expect(2) = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPP 725 P P P P PP+ PPPPPP Sbjct: 24 PPPPSLPPPVP-PPPPSHQPYSYPPPPPPPP 53 Score = 23.0 bits (47), Expect(2) = 4.3 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 711 PPPPPXKXXXPXXXPAPXLKXG 776 PPPPP P P P G Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQG 93 Score = 23.0 bits (47), Expect(2) = 0.24 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAP 761 PPPPPP P P Sbjct: 72 PPPPPPPSAPPPLVPDPP 89 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 5/64 (7%) Frame = +3 Query: 618 KKXXAPXRPXKGPQXP*XR-----PPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXX 782 KK AP P PQ P PP P PPPP P P P + G Sbjct: 365 KKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPR--PPPPMSLGPK 422 Query: 783 TPRP 794 PRP Sbjct: 423 APRP 426 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 610 TPXKKXXPXXGPXRGPXXRKXGPPLXLGFFXXXRPPPPPGK 732 +P + GP R P K PP F PPPPP K Sbjct: 149 SPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPPAK 189 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 5/64 (7%) Frame = +3 Query: 618 KKXXAPXRPXKGPQXP*XR-----PPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXX 782 KK AP P PQ P PP P PPPP P P P + G Sbjct: 365 KKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPR--PPPPMSLGPK 422 Query: 783 TPRP 794 PRP Sbjct: 423 APRP 426 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 610 TPXKKXXPXXGPXRGPXXRKXGPPLXLGFFXXXRPPPPPGK 732 +P + GP R P K PP F PPPPP K Sbjct: 149 SPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPPAK 189 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 33.1 bits (72), Expect = 0.30 Identities = 25/86 (29%), Positives = 27/86 (31%), Gaps = 4/86 (4%) Frame = +3 Query: 642 PXKGPQXP*XRPPAXXGVFXXXP----PPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXX 809 P P P +PP P PPPPP P P P P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQ 101 Query: 810 SXPXXXPAXTPLPGXPXLXTRXRFPP 887 + P PA TP P P T PP Sbjct: 102 TTPPPPPAITPPP--PPAITPPLSPP 125 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +1 Query: 715 PPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPXX 894 PPPP N P P Q P F P P P P PP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSP--PPVATTPPAL 88 Query: 895 RPPXLPP 915 P LPP Sbjct: 89 PPKPLPP 95 Score = 28.7 bits (61), Expect = 6.5 Identities = 26/88 (29%), Positives = 29/88 (32%), Gaps = 4/88 (4%) Frame = +3 Query: 612 PXKKXXAPXRPXKG--PQXP*XRPPAXXGVFXXXPP--PPPPXKXXXPXXXPAPXLKXGX 779 P K P P + P P PP + PP PPPP P P Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAI---TPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 780 XTPRPXFLXXSXPXXXPAXTPLPGXPXL 863 P P + P PA TP P P L Sbjct: 146 PLPPPLSPPQTTPPPPPAITP-PLSPPL 172 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/72 (27%), Positives = 23/72 (31%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P P P PP +F PP PP + P P P + P P Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPR----LPPPLLPPPE 97 Query: 813 XPXXXPAXTPLP 848 P P P P Sbjct: 98 EPPREPPPPPPP 109 Score = 32.7 bits (71), Expect = 0.40 Identities = 24/82 (29%), Positives = 25/82 (30%) Frame = +1 Query: 676 PPLXLGFFXXXRPPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAX 855 PPL PP PP P P PP P P R +LP Sbjct: 30 PPLVFPLLPLSPPPSPP---------PSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLF 80 Query: 856 PXXXPAXAFPPXXRPPXLPPWE 921 P PP PP PP E Sbjct: 81 PPPPLPRLPPPLLPPPEEPPRE 102 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 760 PXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPXXRPPXLPP 915 P L PP P P LP + P PA FPP PP PP Sbjct: 1062 PPLPQESPPPLPPLPPSPP--PPSPPLPPSSLPPPPPAALFPPLPPPPSQPP 1111 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +3 Query: 681 AXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTP 842 A G PPPPPP P P P P P ++ S P P+ P Sbjct: 370 ASFGCSPPSPPPPPPPPPPPPPPPPPPP-PPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/75 (26%), Positives = 22/75 (29%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P P P PP PPPPPP P P P P ++ Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 813 XPXXXPAXTPLPGXP 857 P P P P Sbjct: 437 PPSPPYVYPPPPPSP 451 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/86 (25%), Positives = 22/86 (25%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P P P P P PP PPPPPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Query: 792 PXFLXXSXPXXXPAXTPLPGXPXLXT 869 P P P P P L T Sbjct: 441 PYVYPPPPPSPQPYMYPSPPCNDLPT 466 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = +3 Query: 630 APXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXX 809 +P P P P PP PPPPPP P P P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVY 434 Query: 810 SXPXXXPAXTPLP 848 P P P P Sbjct: 435 PPPPSPPYVYPPP 447 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/68 (26%), Positives = 21/68 (30%) Frame = +1 Query: 712 PPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPX 891 PPPPP P P PP + P P P P +PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYV-YPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Query: 892 XRPPXLPP 915 PP + P Sbjct: 438 PSPPYVYP 445 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 32.3 bits (70), Expect = 0.53 Identities = 25/97 (25%), Positives = 30/97 (30%), Gaps = 5/97 (5%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPP-XKXXXPXXXPAPXLKXG---- 776 P +P P P P PP PPPPPP P P P + Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPV----YSPPPPPPVHSPPPPVFSPPPPVHSPPPPV 643 Query: 777 XXTPRPXFLXXSXPXXXPAXTPLPGXPXLXTRXRFPP 887 P P + P P P+ P L + PP Sbjct: 644 YSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/79 (27%), Positives = 26/79 (32%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P +P P P P PP PPPPP P P P + P Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPV----YSPPPPPVHSPPPPVHSPPPPV---HSPPP 611 Query: 792 PXFLXXSXPXXXPAXTPLP 848 P + S P P +P P Sbjct: 612 PVY---SPPPPPPVHSPPP 627 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/76 (26%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P +P P P P PP PPPPP P P L +P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPV----YSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Query: 792 PXFLXXSXPXXXPAXT 839 S P P+ T Sbjct: 681 TQTPVNSPPPRTPSQT 696 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/80 (27%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXL-KXGXXTP 788 P P P P P PP V+ PPPPP P P P + Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPPP-VYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVH 587 Query: 789 RPXFLXXSXPXXXPAXTPLP 848 P S P P +P P Sbjct: 588 SPPPPVHSPPPPAPVHSPPP 607 Score = 28.7 bits (61), Expect = 6.5 Identities = 29/132 (21%), Positives = 33/132 (25%) Frame = +3 Query: 618 KKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPX 797 K+ P P P P PP PPPP P P P P P Sbjct: 514 KRRSPPPAPVNSPPPPVYSPPPPPPPVHS-PPPPVHSPPPPPVYSPPPPPPPVHSPPPPV 572 Query: 798 FLXXSXPXXXPAXTPLPGXPXLXTRXRFPPXXXXXXXXXXXXXXXXXXTHXHXPXXXXTP 977 F S P + P P PP + P P Sbjct: 573 F---SPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Query: 978 PEXXPPXQTNXP 1013 P PP + P Sbjct: 630 PSQSPPVVYSPP 641 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 615 GGXPPXFXGXPXXPPXDXXXXPXPPXXGPGGGRIXFGXXGXKGP 484 GG P G P P P P GPGG FG G +GP Sbjct: 21 GGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGP--GFGGRGPRGP 62 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXG 776 PPPPPP P P K G Sbjct: 300 PPPPPPPPPPQPLIAATPPRKQG 322 Score = 23.4 bits (48), Expect(2) = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPP 725 P P +PPA PPPPPP Sbjct: 241 PSSPPQQPPATP----PPPPPPPP 260 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.7 bits (66), Expect = 1.6 Identities = 30/116 (25%), Positives = 39/116 (33%), Gaps = 6/116 (5%) Frame = +1 Query: 613 PXKKXXPXXGPXRGPXXRKXGPPLXLGF--FXXXRPPP----PPGKXXYXNXXPRPXLKX 774 P KK P P P +K PP + +PPP PP K + P P K Sbjct: 300 PPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHP--PPVPVYK- 356 Query: 775 GQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPXXRPPXLPPWEXXRALXP 942 PP + P P K P P P PP +P ++ + P Sbjct: 357 ---PPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIP 409 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/71 (25%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +1 Query: 712 PPPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPP- 888 PPP P P + + PP P P K P P P PP Sbjct: 208 PPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPK 267 Query: 889 XXRPPXLPPWE 921 +PP +P ++ Sbjct: 268 IEKPPPVPVYK 278 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 30.7 bits (66), Expect = 1.6 Identities = 28/88 (31%), Positives = 31/88 (35%), Gaps = 2/88 (2%) Frame = -3 Query: 886 GGKRXRVXKXGXPGRGVXAGXXXGXEXXKKXGRGVFXPXLXXGAGXCXGXXXFXG--GGG 713 GGK G G GV G G G G + GAG G G GGG Sbjct: 104 GGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAG---GGIGGGAGGAIGGGASGGVGGGG 160 Query: 712 GGXXXKTPXXAGGLXYGXWGPFXGRXGA 629 G K+ AGG G G G G+ Sbjct: 161 KGRGGKSGGGAGGGVGGGVGAGGGAGGS 188 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/75 (28%), Positives = 24/75 (32%) Frame = -3 Query: 856 GXPGRGVXAGXXXGXEXXKKXGRGVFXPXLXXGAGXCXGXXXFXGGGGGGXXXKTPXXAG 677 G G G G G + + G G + G G G G GGG G Sbjct: 91 GAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGG 150 Query: 676 GLXYGXWGPFXGRXG 632 G G G GR G Sbjct: 151 GASGGVGGGGKGRGG 165 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLP 848 PPPPPP P P PR F P PLP Sbjct: 10 PPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLP 56 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/46 (30%), Positives = 18/46 (39%) Frame = +3 Query: 711 PPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLP 848 PPPPP P P+P + P ++ S P P P P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/69 (27%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +1 Query: 715 PPPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFP--P 888 PPP K P Q PP + P P + P+ + P P P P Sbjct: 488 PPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Query: 889 XXRPPXLPP 915 PP PP Sbjct: 548 TYSPPIKPP 556 Score = 29.9 bits (64), Expect = 2.8 Identities = 25/95 (26%), Positives = 32/95 (33%), Gaps = 4/95 (4%) Frame = +1 Query: 643 PXRGPXXRKXGPPLXLGFFXXXRPPP--PPGKXXYXNXXPRPXLKXGQXPPARXFXPXXX 816 P + P K P+ + +PPP P Y P L Q PP + P Sbjct: 368 PVKPPPVHKPPTPI---YSPPVKPPPIQKPPTPTYSPPIKPPPL---QKPPTPTYSPPIK 421 Query: 817 XXPXRXKLPSXAXPXXXPAXAFP--PXXRPPXLPP 915 P + P + P P P P PP PP Sbjct: 422 LPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 29.5 bits (63), Expect = 3.7 Identities = 26/100 (26%), Positives = 34/100 (34%), Gaps = 3/100 (3%) Frame = +1 Query: 676 PPLXLGFFXXXRPPP---PPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXPXRXKLPS 846 PP + + +PPP PP P P K PP + P P + P+ Sbjct: 427 PPTPI-YSPPVKPPPVHKPPTPIYSPPVKPPPVHK----PPTPTYSPPIKPPPVKPPTPT 481 Query: 847 XAXPXXXPAXAFPPXXRPPXLPPWEXXRALXPLTXTXRXP 966 + P P PP P PP + P T T P Sbjct: 482 YSPPVQPPPVQKPP--TPTYSPPVKPPPIQKPPTPTYSPP 519 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/72 (29%), Positives = 25/72 (34%), Gaps = 4/72 (5%) Frame = +1 Query: 712 PP--PPPGKXXYXNXXPRPXLKXGQXPPARXFXPXXXXXP-XRXKLPSXAXPXXXPAXAF 882 PP PPP K P Q PP + P P + P+ + P P Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKP 527 Query: 883 P-PXXRPPXLPP 915 P P PP PP Sbjct: 528 PTPTYSPPIKPP 539 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/84 (28%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXX-GVFXXXPPPPPP-XKXXXPXXXPAPXLKXGXXT 785 P P P P P PPA V PPPPPP P P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQ 101 Query: 786 PRPXFLXXSXPXXXPAXTPLPGXP 857 P P + P P P P Sbjct: 102 PPPKPPQKNLPRRHPPPPRSPEKP 125 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLPGXP 857 PPPPPP + P P P P + S P P P P P Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTP-IVHTSSPPPPPPPPPPPAPP 740 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/78 (26%), Positives = 23/78 (29%) Frame = +3 Query: 654 PQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPA 833 P P PP PPPPPP P P P + P P P P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPP----APPAPPTPIVHTSSPPPPP-------PPPPPP 737 Query: 834 XTPLPGXPXLXTRXRFPP 887 P P + PP Sbjct: 738 APPTPQSNGISAMKSSPP 755 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 1/81 (1%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXX-PAPXLKXGXXTP 788 P K P K P PP PP P P P P P P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Query: 789 RPXFLXXSXPXXXPAXTPLPG 851 P P PA P PG Sbjct: 111 APAPAPTPAPKPKPAPKPAPG 131 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P +P P +P P P P P PAP TP P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPT-PPKP 108 Query: 813 XPXXXPAXTPLP 848 P PA TP P Sbjct: 109 KPAPAPAPTPAP 120 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS---XPXXXPAXTPLPG 851 PPPPPP P P+P G +P P S P P+ +P PG Sbjct: 164 PPPPPPYPSPLP-PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPG 213 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/76 (27%), Positives = 25/76 (32%), Gaps = 3/76 (3%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P P P P G P P P P P+P G +P P S Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDS 225 Query: 813 ---XPXXXPAXTPLPG 851 P P+ +P PG Sbjct: 226 PLPLPGPPPSSSPTPG 241 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRP---XFLXXSXPXXXPAXTPLPGXP 857 PPPPP P P+P P P L P P+ TP P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/61 (31%), Positives = 23/61 (37%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P ++ P P G Q P PP G+ PPPP + P P G PR Sbjct: 191 PPQQFSGPPPPQYG-QRPMIPPPG--GMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPR 247 Query: 792 P 794 P Sbjct: 248 P 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/61 (31%), Positives = 23/61 (37%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P ++ P P G Q P PP G+ PPPP + P P G PR Sbjct: 191 PPQQFSGPPPPQYG-QRPMIPPPG--GMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPR 247 Query: 792 P 794 P Sbjct: 248 P 248 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/75 (28%), Positives = 24/75 (32%) Frame = +3 Query: 633 PXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXS 812 P P P PP + PPP PP P P+P P P S Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSP--TTPS 97 Query: 813 XPXXXPAXTPLPGXP 857 P P +P G P Sbjct: 98 NPRSPP--SPNQGPP 110 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -3 Query: 760 GAGXCXGXXXFXGGGGGGXXXKTPXXAGGLXYGXWGPFXGRXG 632 G G G + GGGGGG GG G +G G G Sbjct: 199 GGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGG 241 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 708 PPPPPPX---KXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLP 848 PPPPPP + P P P ++ P P L P PLP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -3 Query: 760 GAGXCXGXXXFXGGGGGGXXXKTPXXAGGLXYGXWGPFXGRXGAXXFXXG 611 G G G F GG GGG GG YG G GR G+ + G Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGG-GGRGGSDCYKCG 135 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPA-XTPLPGXP 857 PPPPPP P P P +P P L PA P P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/81 (28%), Positives = 26/81 (32%), Gaps = 2/81 (2%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPP--PPPPXKXXXPXXXPAPXLKXGXXT 785 P +P P P P P V+ PP PPP P P P Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP--PPVFSP 602 Query: 786 PRPXFLXXSXPXXXPAXTPLP 848 P P F S P P +P P Sbjct: 603 PPPVF---SPPPPSPVYSPPP 620 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = -3 Query: 829 GXXXGXEXXKKXGRGVFXPXLXXGAGXCXGXXXFXGGGGGGXXXKTPXXAGGLXYGXWG- 653 G G K G+G+ P G G G GGGGG GG G G Sbjct: 291 GGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGG 350 Query: 652 --PFXGRXG 632 P G+ G Sbjct: 351 GHPLDGKMG 359 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 642 PXKGPQXP*XRPPAXXGVFXXXPPPPPP 725 P P P PP F PPPPPP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +3 Query: 675 PPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLPGX 854 PPA PPP P P P P G P + P P P G Sbjct: 507 PPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQGP 566 Query: 855 P 857 P Sbjct: 567 P 567 >At2g23770.1 68415.m02839 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains Pfam domains, PF00069: Protein kinase domain and PF01476: LysM domain Length = 612 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 663 P*XRPPAXXGVFXXXPPPPPPXKXXXPXXXP 755 P PPA PPPPPP P P Sbjct: 232 PLVNPPANTNSLIPPPPPPPPQSVSPPPLSP 262 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 760 GAGXCXGXXXFXGGGGGGXXXKTPXXAGGLXYGXWGPFXGRXG 632 G G G GGGGGG GG YG G G G Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/79 (24%), Positives = 21/79 (26%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P K P P P PPA P PPP P +P P Sbjct: 83 PAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPA 142 Query: 792 PXFLXXSXPXXXPAXTPLP 848 P + P P P Sbjct: 143 PASPPPAPVSPPPVQAPSP 161 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 708 PPPPPPXKXXXPXXXPAPXLKXGXXTPRP 794 PPPPP + P AP +K G TP+P Sbjct: 240 PPPPPQQQRVQPQQKRAPTVKDG--TPKP 266 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 639 RPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLK 770 +P P P P PPPPP K P P P LK Sbjct: 238 KPDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLK 281 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/79 (27%), Positives = 28/79 (35%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P K P P P PA V+ PPPP P +P K +P Sbjct: 579 PAYKSSPPPYVYSSPPPP-YYSPAPKPVYKS--PPPPYVYNSPPPPYYSPSPKPTYKSPP 635 Query: 792 PXFLXXSXPXXXPAXTPLP 848 P ++ S P + TP P Sbjct: 636 PPYVYSSPPPPYYSPTPKP 654 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAP 761 P P +P P P PP PPPPP P PAP Sbjct: 45 PPPHFSPPHQPPPSPY-PHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 6.5 Identities = 28/98 (28%), Positives = 33/98 (33%), Gaps = 3/98 (3%) Frame = +1 Query: 631 PXXGPXRGPXXRKXGPPLXLGFFXXXRPPPPP---GKXXYXNXXPRPXLKXGQXPPARXF 801 P P + P + GPP G PPPP G+ P + G PP Sbjct: 158 PGQMPPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQ 217 Query: 802 XPXXXXXPXRXKLPSXAXPXXXPAXAFPPXXRPPXLPP 915 P P R +P P P A PP P PP Sbjct: 218 GP----PPSRPGMP---PPGGAPMFA-PPHPGMPPAPP 247 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/71 (26%), Positives = 23/71 (32%) Frame = +3 Query: 675 PPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPRPXFLXXSXPXXXPAXTPLPGX 854 PP PPPPP P P+P P P + P PA P Sbjct: 746 PPQSHPPCIEYSPPPPPTVHYNPPPPPSP--AHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 Query: 855 PXLXTRXRFPP 887 P + + PP Sbjct: 804 PPVIHHSQPPP 814 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXK 731 P K P P P PP PPPPPP K Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPK 344 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPP 725 P + P P P +PP V PPPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 724 GGGGGGXXXKTPXXAGGLXYGXWGPFXGRXG 632 GGGG G + +GG YG +G GR G Sbjct: 516 GGGGYGSYGSSSGRSGGGSYGGYGGSSGRSG 546 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P A P P P PP PPP P PAP K +P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPS 138 Query: 792 P 794 P Sbjct: 139 P 139 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPAPXLKXGXXTPR 791 P A P P P PP PPP P PAP K +P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPS 138 Query: 792 P 794 P Sbjct: 139 P 139 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +3 Query: 672 RPPAXXGVFXXXPPPPPPX---KXXXPXXXPAPXLKXGXXTPRP 794 +PP PPPPPP K P P P +K G +P P Sbjct: 226 QPPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKG-SSPSP 268 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -3 Query: 856 GXPGRGVXAGXXXGXEXXKKXGRGVFXPXLXXGAGXCXGXXXFXGGGGGG 707 G PG G G G G GV + G G C G GGGGGG Sbjct: 155 GGPGYGSGGGGIGGGGGI---GGGVI---IGGGGGGCGGSCSGGGGGGGG 198 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/62 (27%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +3 Query: 612 PXKKXXAPXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPA-PXLKXGXXTP 788 P P P + P P P PPPPP P P P TP Sbjct: 139 PSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTP 198 Query: 789 RP 794 P Sbjct: 199 LP 200 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/70 (27%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 642 PXKGPQXP*XRPPAXXGVFXXXPPPPPPXKXXXPXXXPA---PXLKXGXXTPRPXFLXXS 812 P P PP+ PPPPPP K P + P L P P F Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFE 104 Query: 813 XPXXXPAXTP 842 P +P Sbjct: 105 STPPPPPLSP 114 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 630 APXRPXKGPQXP*XRPPAXXGVFXXXPPPPPPXK 731 AP +GP P PP PPPPPP + Sbjct: 12 APGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPPR 45 >At3g24250.1 68416.m03044 glycine-rich protein Length = 137 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 760 GAGXCXGXXXFXGGGGGGXXXKTPXXAGGLXYGXWGPFXGRXGAXXFXXG 611 G G GGG GG P +G G G G GA F G Sbjct: 70 GVAGVGGFMGMPGGGSGGSGMTFPLPSGTPLLGGAGGLGGLGGAMGFPGG 119 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 28.3 bits (60), Expect = 8.6 Identities = 24/102 (23%), Positives = 30/102 (29%), Gaps = 1/102 (0%) Frame = +1 Query: 613 PXKKXXPXXGPXRGPXXRKXGPPLXLGFFXXXR-PPPPPGKXXYXNXXPRPXLKXGQXPP 789 P + P P P PP ++ PPPP Y P P PP Sbjct: 562 PVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSP------PPP 615 Query: 790 ARXFXPXXXXXPXRXKLPSXAXPXXXPAXAFPPXXRPPXLPP 915 + + P P P + P PP P PP Sbjct: 616 SPLYYPPVTPSP-----PPPSPVYYPPVTPSPPPPSPVYYPP 652 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 24.2 bits (50), Expect(2) = 9.8 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 711 PPPPPXKXXXPXXXPAPXLKXGXXTPRP 794 PPPPP PAP + P P Sbjct: 231 PPPPPNMNQNYQGPPAPNMNQNYQGPPP 258 Score = 22.2 bits (45), Expect(2) = 9.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 672 RPPAXXGVFXXXPPPP 719 RPP G+ PPPP Sbjct: 192 RPPPNQGMGGAPPPPP 207 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.143 0.474 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,495,099 Number of Sequences: 28952 Number of extensions: 177882 Number of successful extensions: 2676 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1742 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2491999472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -