BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F09 (915 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48590.1 68418.m06010 expressed protein 29 4.3 At4g32300.1 68417.m04596 lectin protein kinase family protein co... 29 5.7 At3g03230.1 68416.m00319 esterase/lipase/thioesterase family pro... 29 5.7 At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative... 28 9.9 At1g67870.1 68414.m07750 glycine-rich protein contains non-conse... 28 9.9 >At5g48590.1 68418.m06010 expressed protein Length = 344 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = -2 Query: 410 LRRRAAPRSRECGSRSGSARARLHCPERAPAETALSLWRSLKS--ADPMALSTFL 252 LRR A PRS E S L PE + E+ ++ + SLK + +A TFL Sbjct: 263 LRRCAKPRSHEAKSLIEKQSLALFGPEESSKESIVTSFSSLKRLLLEAVAFGTFL 317 >At4g32300.1 68417.m04596 lectin protein kinase family protein contains Pfam domains, PF01453: Lectin (probable mannose binding) and PF00069: Protein kinase domain Length = 821 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 431 CGTN*PCLRRRAAPRSRECGSRSGSARARLHC 336 CGT PC S+ CG SG +RAR C Sbjct: 284 CGTPEPCGPYYVCSGSKVCGCVSGLSRARSDC 315 >At3g03230.1 68416.m00319 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 333 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 425 FHNNNHDLSAKGVRDQELAQRHSQRAQLQHAGRRSGLHVQTE 550 F N+ + RD ELA++H++ + ++ + R G +V T+ Sbjct: 208 FPNSRNPKDTMTERDLELAEKHTKHSYIKESALRQGGYVTTQ 249 >At2g40930.1 68415.m05052 ubiquitin-specific protease 5, putative (UBP5) similar to GI:6648604 Length = 924 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/64 (25%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -2 Query: 653 ERAGRRSEQVQLTP-GXXXXXXXXXXXXRAQRCAHLLFEHVVHSAAQRVEVGRVGNGAGR 477 ++AG R VQL P G + H L ++++ + VG+ GN Sbjct: 602 QKAGERESTVQLKPCGTPLLSSASCGDALTKGKIHCLVQNMLSPFRREESVGKKGNSDSS 661 Query: 476 VPDR 465 +P+R Sbjct: 662 IPER 665 >At1g67870.1 68414.m07750 glycine-rich protein contains non-consensus GG donor splice site at exon2; modeled to est match. Length = 279 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +2 Query: 323 GLALDNVNGHGLSLTGTRIPGFGEQLGVAGKVNLFHNNNHDLSAKGVRDQELAQRHSQRA 502 G + + GHG+ G G Q G + H H + + + + RH + Sbjct: 165 GHGMQHQGGHGMQHQGMH--GMQHQ----GGHGMEHQGGHGMQHQDMHGMQHQGRHGMQH 218 Query: 503 QLQHAGRRSGLH-VQTEGG-RIVERG 574 Q H + G+H +Q +GG RI +G Sbjct: 219 QGGHEMQHQGMHGMQHQGGHRIQHQG 244 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,589,233 Number of Sequences: 28952 Number of extensions: 249842 Number of successful extensions: 733 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -