BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F07 (1075 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 39 0.008 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 38 0.014 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.042 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.098 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 35 0.098 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.13 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.52 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 0.91 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.2 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 1.6 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 30 3.7 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 26 4.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 4.9 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 4.9 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 4.9 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 4.9 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 29 4.9 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.2 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 5.9 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 25 6.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.5 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.5 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.5 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PP PPP G GG PPPPPP Sbjct: 305 PPPPPPGGAPPPPPPP-----PPPPPGDGGA--PPPPPPP 337 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPP----FCLXXPPPXWGGGGXGXXPPPPPP 424 PPP G P PP PPP G G PPPPPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.69 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 323 GGGEXPXXPPF---CLXXPPPXWGGGGXGXXPPPPPP 424 GG P PP PPP GG PPPPPP Sbjct: 287 GGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 31.9 bits (69), Expect = 0.91 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PP G P PP PPP GG PPPPPP Sbjct: 292 PPPPPADGSAPAPPP-----PPPP-GGAPPPPPPPPPPP 324 Score = 28.7 bits (61), Expect = 8.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 414 GGGXXPXPPPPQXGGGXXKQKGGXXGXSPPP 322 GGG PPPP G G +PPP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPP 316 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 423 GGGGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 GG GG P PPPP GG G +PPP G G Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFG 708 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPP----FCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PP PPP GGG PPPPPP Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGA----PPPPPP 705 Score = 33.5 bits (73), Expect = 0.30 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG+ PP PPP GG PPPPPP Sbjct: 662 PPPPPPPGGQAGGAPP----PPPPPLPGGAA---PPPPPP 694 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 36.3 bits (80), Expect = 0.042 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +2 Query: 305 PPPXLXGG----GEXPXXPPFC--LXXPPPXWGGGGXGXXPPPPPP 424 PPP L G P PP C L PPP G G PPPPPP Sbjct: 701 PPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 33.1 bits (72), Expect = 0.40 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 305 PPPXLXGGGEXPXXP-PFC--LXXPPPXWGGGGXGXXPPPPP 421 PPP G P P P C L PPP G G PPPPP Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 32.3 bits (70), Expect = 0.69 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 290 KKXXXPPPXLXG-GGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 KK PPP L G PP PPP G PPPPPP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.1 bits (77), Expect = 0.098 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PPP G PPPPPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 33.5 bits (73), Expect = 0.30 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPP 421 P GG E P P PPP GG PPPPP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPP 937 Score = 33.5 bits (73), Expect = 0.30 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 411 GGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 GG P PPPP GG Q G +PPP GG Sbjct: 927 GGNAPLPPPP-PGGSAPSQPPPPGGNAPPPPPPPGG 961 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGG-----GXGXXPPPPPP 424 PPP G PP PPP GG G G P PPPP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 394 PPPPPXGGGXXQTKGGGXXXFPP 326 PPPPP GG GGG PP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPP 975 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PPP PPPPPP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPPQQ 430 PPP GGG P PP PPP PPPPPP + Sbjct: 964 PPP---GGGAPPLPPPPGGSAPPPP------PPPPPPPPPMR 996 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 411 GGXXPXPPPPQXGGGXXKQKGGXXGXSPPP 322 GG P PPPP GG GG PPP Sbjct: 949 GGNAP-PPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPP 418 PPP G P PP P GG PPPP Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.1 bits (77), Expect = 0.098 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PP GGG P PP PPP GGG P PPPP Sbjct: 653 PPPPPGGGMFPPPPP-----PPP---GGGVPGPPKPPPP 683 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 350 PFCLXXPPPXWGGGGXGXXPPPPP 421 PF PPP GGG PPPPP Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPP 670 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 415 GGGXXAXPPPPPXGGG 368 GGG PPPPP GGG Sbjct: 658 GGGMFPPPPPPPPGGG 673 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 305 PPPXLXGGGEXPXXP-PFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP + P P PPP GG PPPPPP Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPF----CLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PPF PPP G PPPPPP Sbjct: 281 PPPPPLTGGMLP--PPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -2 Query: 399 PXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGGXXXFXKKXXPP 271 P PPPP GG GG +PPP G PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 28.7 bits (61), Expect = 8.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 332 EXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 + P PP PP +GG PPPP P Sbjct: 279 QPPPPPPLTGGMLPPPFGGHPAAAPPPPPLP 309 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 32.7 bits (71), Expect = 0.52 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 417 GGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 GGG PPP GG G G PPP G G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 522 Score = 32.3 bits (70), Expect = 0.69 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 423 GGGGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 G G GG P P Q GG G G PP GGG Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG 535 Score = 32.3 bits (70), Expect = 0.69 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 423 GGGGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 G G GG P P Q GG G G PP GGG Sbjct: 529 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG 568 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 420 GGGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 G G G P PP G G G G PPP GG Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 545 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 420 GGGGGXXPXPPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 G G G P PP G G G G PPP GG Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 578 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 9/49 (18%) Frame = -2 Query: 423 GGGGGGXXPXP--------PPPQXG-GGXXKQKGGXXGXSPPPXNXGGG 304 G G GG P P PPP G GG G G PPP G G Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 415 GGGXXAXPPPPPXGGGXXQTKGGG-XXXFPPAAQXGGG 305 G G PPPP G G G G PP A GGG Sbjct: 562 GAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 423 GGGGGGXXPXPPPPQXGGGXXK-QKGGXXGXSPPPXNXGGG 304 G G GG PPPP G G + G G PPP G G Sbjct: 540 GAGQGG---GPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 577 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = -2 Query: 420 GGGGGXXPX------PPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 G GGG P PPPP G G G PPP G G Sbjct: 564 GQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQG 608 Score = 29.9 bits (64), Expect = 3.7 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -1 Query: 415 GGGXXAXPPPPPXGGGXXQTKGG---GXXXFPPAAQXGGGXXXFFXKKXPP 272 G G PPPP G G Q G G PP A GG ++ PP Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPP 590 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPP 415 PPP G G P PP PP G G G PPP Sbjct: 569 PPPPGAGQGGPP--PPGAGQEGPPPPGAGQGGGPPPP 603 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.3 bits (70), Expect = 0.69 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP G P PP PPP G PPPPPP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNG----PPPPPPP 410 Score = 29.1 bits (62), Expect = 6.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP G PPPPPP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNG----PPPPPPP 400 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.9 bits (69), Expect = 0.91 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP GG P PP + PP G PPPPPP Sbjct: 365 PPPPPPVGGPPPPPPP--IEGRPP----SSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWG-----GGGXGXXPPPPPP 424 PPP + P PP PPP G GG PPPPPP Sbjct: 327 PPPPPSRSSQRPP-PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 30.3 bits (65), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPPQQ 430 PPP G P PP PPP G PPPPPP + Sbjct: 297 PPPPSRGA---PPPPPSRGSAPPPP--PARMGTAPPPPPPSR 333 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP G P PPP GG PPPPPP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGG-----PPPPPPP 380 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGG 388 PPP GG P PPF PP GG Sbjct: 202 PPPGFPGGAPPPPPPPFGAPPPPALNGG 229 Score = 29.1 bits (62), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 399 PXPPPPQXGGGXXKQKGGXXGXSPPPXNXGG 307 P PPPP GG G PPP GG Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 329 GEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 G P PP PPP + GG PPPPPP Sbjct: 193 GMPPPPPP----PPPPGFPGGAP---PPPPPP 217 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +2 Query: 284 FXKKXXXPPPXLXG-GGEXPXXPPFCLXXP---PPXWGGGGXGXXPPPPPP 424 + +K PP + G P P P PP GG G PPPPPP Sbjct: 182 YPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPP 232 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP G E P P P P G PPPPPP Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSP--ASPGLPFMPPPPPP 93 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.3 bits (65), Expect = 2.8 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +2 Query: 305 PPPXLXG---GGEXPXXPPFCLXXPPPXWGGGGXGXXPPP---PPPQQ 430 PPP + G P PP PPP + PPP PPPQQ Sbjct: 284 PPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPPQQ 331 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.9 bits (64), Expect = 3.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 29.5 bits (63), Expect = 4.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 29.5 bits (63), Expect = 4.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 29.1 bits (62), Expect = 6.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 PPP P PP PPP PPPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 407 PPPPPPQQXXXXWFF 451 PPPPPP W++ Sbjct: 218 PPPPPPPMLARRWYY 232 Score = 22.2 bits (45), Expect(2) = 4.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 392 GXGXXPPPPPP 424 G PPPPPP Sbjct: 207 GDAKPPPPPPP 217 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPP---PPP 424 PP P PP PPP G G PPP PPP Sbjct: 231 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 272 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPP 421 PPP + G PP PPP G PPPPP Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSN----PPPPP 284 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.5 bits (63), Expect = 4.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGG 394 PPP GG P PP PPP GGG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 29.5 bits (63), Expect = 4.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 393 PPPPQXGGGXXKQKGGXXGXSPPPXNXGGG 304 PPPP GG G PPP GGG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 Score = 29.1 bits (62), Expect = 6.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 329 GEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 G P+ PPP G GG PPPPPP Sbjct: 183 GSPTEDTPWTSVPPPPPPGPGGI---PPPPPP 211 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.5 bits (63), Expect = 4.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPP---PPP 424 PP P PP PPP G G PPP PPP Sbjct: 143 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 184 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPP 421 PPP + G PP PPP G PPPPP Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSN----PPPPP 196 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 578 GGGGGGGGGXXXXXXXGGA 522 GGGGGGGGG GGA Sbjct: 1007 GGGGGGGGGGGRRGGRGGA 1025 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 578 GGGGGGGGGXXXXXXXGGA 522 GGGGGGGGG GGA Sbjct: 684 GGGGGGGGGGGGGGGGGGA 702 Score = 29.5 bits (63), Expect = 4.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 578 GGGGGGGGGXXXXXXXGGA 522 GGGGGGGGG GGA Sbjct: 687 GGGGGGGGGGGGGGGAGGA 705 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 25.8 bits (54), Expect(2) = 5.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 371 PPXWGGGGXGXXPPPPPP 424 P G GG PPPPPP Sbjct: 784 PEGEGVGGITPPPPPPPP 801 Score = 21.8 bits (44), Expect(2) = 5.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 407 PPPPPPQ 427 PPPPPP+ Sbjct: 800 PPPPPPE 806 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 575 GGGGGGGGXXXXXXXGG 525 GGGGGGGG GG Sbjct: 122 GGGGGGGGFYQDSYGGG 138 Score = 22.2 bits (45), Expect(2) = 5.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 578 GGGGGGGGG 552 GGG GGGGG Sbjct: 105 GGGYGGGGG 113 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 25.4 bits (53), Expect(2) = 6.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 575 GGGGGGGGXXXXXXXGG 525 GGGGGGGG GG Sbjct: 110 GGGGGGGGGFGGGGGGG 126 Score = 22.2 bits (45), Expect(2) = 6.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 578 GGGGGGGGG 552 GGG GGGGG Sbjct: 84 GGGFGGGGG 92 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 6.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 368 PPPXWGGGGXGXXPPPPPP 424 PPP G G PPPPPP Sbjct: 757 PPPPPAVPGEGARPPPPPP 775 Score = 29.1 bits (62), Expect = 6.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 368 PPPXWGGGGXGXXPPPPPP 424 PPP G G PPPPPP Sbjct: 759 PPPAVPGEGARPPPPPPPP 777 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 308 PPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPPQ 427 PP G P PPF PPP G P PP PQ Sbjct: 1253 PPPPPGMRPMPPQPPFM--PPPPRMQPPGPPGPPGPPGPQ 1290 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 338 PXXPPFCLXXPPPXWGGGGXGXXPPPPPP 424 P PP C PPP PPPPPP Sbjct: 93 PACPPACCAPPPPP----PPPPPPPPPPP 117 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 305 PPPXLXGGGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPPPQQ 430 PPP L + P PP PP PPPPPP++ Sbjct: 199 PPPPLDDLDDLPPPPP----PPPEDDSIHNHEDLPPPPPPKE 236 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 28.7 bits (61), Expect = 8.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 308 PPXLXG--GGEXPXXPPFCLXXPPPXWGGGGXGXXPPPPP 421 PP G G P PP P P GGG G PP P Sbjct: 1077 PPGYPGFKGYRGPQGPPGIAGEPGPPGIGGGIGYMGPPGP 1116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,649,210 Number of Sequences: 59808 Number of extensions: 305848 Number of successful extensions: 4230 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3024 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3248925682 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -