BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F06 (899 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|... 26 6.3 SPBC685.02 |||conserved eukaryotic protein|Schizosaccharomyces p... 26 6.3 SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|... 26 8.4 >SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 26.2 bits (55), Expect = 6.3 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 48 CHSCLKQRNLTQVKMNSKLLYFFATVL-VCVNAEVYWEDEEGYPVSGQFSKRHPRDVT 218 C S LK L VK + L + L +C N+ +W + + F K ++VT Sbjct: 246 CESILKDYLLNLVKTSESLSSQQMSCLRICCNSSSFWSAADSFKEVSSFLKNLLKNVT 303 >SPBC685.02 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 409 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 545 FETIPPAERRVFLSRSHTPEPVAV 474 +ET PP+ERRV L R+ EP A+ Sbjct: 117 YETSPPSERRV-LDRTSKEEPWAL 139 >SPCC330.06c |||thioredoxin peroxidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 156 Score = 25.8 bits (54), Expect = 8.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 377 PCGSQDPGAVGLPGQFAAVIIEDLSVV 297 PC SQ PG + QFAA I + VV Sbjct: 42 PCSSQVPGYIANEKQFAAKGISGIYVV 68 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,255,916 Number of Sequences: 5004 Number of extensions: 68125 Number of successful extensions: 153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -